DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG7248

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster


Alignment Length:305 Identity:67/305 - (21%)
Similarity:106/305 - (34%) Gaps:108/305 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QSSFKCPD-DFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDR 81
            |:|..|.. ..|||.:..:|..|..|.:..::|:.|.:|..|::.     .:.||....|||   
  Fly    57 QNSTYCESLSNGFYEYPYNCSAYITCYDSCADLEYCPDGKLFNSP-----LQICDTPGAVDC--- 113

  Fly    82 TELEP-PITTPH---------C--SRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARV 134
               || |..||.         |  :|...:.|....|:.|:.|.|.:...|:|...:.::.|..:
  Fly   114 ---EPLPYPTPSPTESPPENPCLGTRNNTLLPSAENCNEFYLCVNDQSKVYRCPGEMLFNPDLNI 175

  Fly   135 C-----MWA-----------------DQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCR 177
            |     :|.                 :...:|:::|               .|:|  ...||:|:
  Fly   176 CDDKDNVWCYGDRTTPDPLDTTTPAEESFTKCEDQE---------------KGTF--FPDPENCQ 223

  Fly   178 KYYICLEGVAREY---GCPIGTVFKIGDSDGTGNCEDPEDVP-GC-------------------- 218
            :||.|...  :.|   .||:...|    :..:||| .|:..| .|                    
  Fly   224 QYYYCWGN--KSYTILPCPVDNWF----NPISGNC-GPDIAPDACRETTPTSTPTIDTSSSTTVA 281

  Fly   219 ----EDYYGD----------LDLKSIRKSELLAGLNSEGRTKGAP 249
                ||..|:          ..:||..:|.||...|.|..|...|
  Fly   282 PTSTEDSVGNPCADQELGASFPIKSDCQSYLLCLNNGESTTAKCP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 12/51 (24%)
CBM_14 97..144 CDD:366726 10/68 (15%)
CBM_14 170..218 CDD:366726 15/51 (29%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884 14/55 (25%)
CBM_14 136..182 CDD:279884 10/45 (22%)
CBM_14 207..261 CDD:279884 19/77 (25%)
CBM_14 293..347 CDD:279884 9/34 (26%)
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443981
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.