DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG17826

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster


Alignment Length:198 Identity:53/198 - (26%)
Similarity:78/198 - (39%) Gaps:54/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PHDTSCDKYWKCDNGVSELKTCGNGLAFDAT--DSKYLTEN------CDYLHNVDCGDRTELEPP 87
            |.|  |..|.:|.|||...:.|.....|:.|  :.:..|||      ||    .||.|       
  Fly   571 PAD--CAGYLQCINGVFVARKCSATQFFNTTLKECEVDTENVCIPKTCD----PDCCD------- 622

  Fly    88 ITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANG 152
              .|:.|    |:|.|..|..|:.|.||.....:||..|.|:.....|.:.:.| :|.:.     
  Fly   623 --VPNNS----IWPVEKNCSAFYQCVNGNKYEQRCSNNLQYNSIIEQCDYPENV-QCDDG----- 675

  Fly   153 FSCPAAGELAN-AGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCEDPEDVP 216
             |.|.:|.:|. :|::        |..:..|:       |...||:|    :|.:|:|.....|.
  Fly   676 -SAPPSGPIAGPSGTY--------CESHGRCV-------GQRDGTMF----ADASGDCSSNYVVC 720

  Fly   217 GCE 219
            .||
  Fly   721 QCE 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 15/48 (31%)
CBM_14 97..144 CDD:366726 14/46 (30%)
CBM_14 170..218 CDD:366726 10/47 (21%)
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696
CBM_14 145..184 CDD:279884
CBM_14 251..290 CDD:279884
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884 13/40 (33%)
CBM_14 621..670 CDD:279884 16/61 (26%)
CBM_14 697..749 CDD:279884 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.