Sequence 1: | NP_649611.2 | Gene: | Gasp / 40745 | FlyBaseID: | FBgn0026077 | Length: | 258 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648528.1 | Gene: | CG17826 / 39354 | FlyBaseID: | FBgn0036227 | Length: | 751 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 53/198 - (26%) |
---|---|---|---|
Similarity: | 78/198 - (39%) | Gaps: | 54/198 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 PHDTSCDKYWKCDNGVSELKTCGNGLAFDAT--DSKYLTEN------CDYLHNVDCGDRTELEPP 87
Fly 88 ITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANG 152
Fly 153 FSCPAAGELAN-AGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCEDPEDVP 216
Fly 217 GCE 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gasp | NP_649611.2 | ChtBD2 | 21..72 | CDD:214696 | 15/48 (31%) |
CBM_14 | 97..144 | CDD:366726 | 14/46 (30%) | ||
CBM_14 | 170..218 | CDD:366726 | 10/47 (21%) | ||
CG17826 | NP_648528.1 | CBM_14 | 36..74 | CDD:279884 | |
ChtBD2 | <89..124 | CDD:214696 | |||
CBM_14 | 145..184 | CDD:279884 | |||
CBM_14 | 251..290 | CDD:279884 | |||
CBM_14 | 357..396 | CDD:279884 | |||
CBM_14 | 463..502 | CDD:279884 | |||
CBM_14 | 563..610 | CDD:279884 | 13/40 (33%) | ||
CBM_14 | 621..670 | CDD:279884 | 16/61 (26%) | ||
CBM_14 | 697..749 | CDD:279884 | 11/38 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45443977 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |