DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG5883

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:269 Identity:55/269 - (20%)
Similarity:92/269 - (34%) Gaps:92/269 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GFYPHDTSCDKYWKCD-NGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTEL--EPPIT 89
            |:.....:|..::.|| :.:....||..|:.||     .::::|.|..:..|..:.|:  ..|:.
  Fly   101 GYIGDTINCANWYYCDADALLGKGTCNLGMYFD-----QVSKSCVYSEDTVCAAKYEICDVAPVG 160

  Fly    90 TPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQV-------PE--CK 145
            ||        |.|:..|..::.|.:.......|..||.|:.....|:....|       |:  |.
  Fly   161 TP--------FRDDANCHKYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICENHPLPDEVCG 217

  Fly   146 NEEVA--NGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTV----------- 197
            |:::|  |.|    ..::|.            ||.||.|     |:.|..|...           
  Fly   218 NKKLAVRNKF----VSDMAT------------CRGYYYC-----RDLGSGIPDTDPIYQQCDENN 261

  Fly   198 ----------------------------FKIGDSDGTGN---CED-PEDVP-GCEDYYGDLDLKS 229
                                        |::.:.||..:   |.| .|..| .|||.|.|:..::
  Fly   262 FFNQERQACMPRESQKCDYDRCDGRKDGFEVAEIDGCHHYIECVDGRETTPISCEDKYFDVVTQN 326

  Fly   230 IRKSELLAG 238
            ...:.|:.|
  Fly   327 CSSTHLVYG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 10/44 (23%)
CBM_14 97..144 CDD:366726 11/55 (20%)
CBM_14 170..218 CDD:366726 15/91 (16%)
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 11/49 (22%)
CBM_14 154..204 CDD:279884 12/57 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.