DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG4835

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:308 Identity:61/308 - (19%)
Similarity:90/308 - (29%) Gaps:107/308 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CPD--DFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDC-GDRTEL 84
            |.|  |...:.:..:|.:|..|.:...::..|.....|   :...|.  ||...:|.| ||||..
  Fly   393 CKDEKDGTIFAYIGNCSEYLICKDNQVQMGHCPPNTLF---NPDLLV--CDEPDDVVCLGDRTTT 452

  Fly    85 EPPITTPHCS--------------------------RLYGIFPDENKCDVFWNCWNG-------- 115
            ..|.|.|..:                          .|...|...:.|..::.|..|        
  Fly   453 PIPTTIPTTTTEKTTPTTTTTTVATTLGPDQLCDGQELGASFSYPDDCSKYYLCLGGGQWTLAPC 517

  Fly   116 ------EPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANGFS-------------------- 154
                  :||..||.|.:|.|             .||..:|....:                    
  Fly   518 IYGSYFDPSTGQCGPDVAPD-------------ACKPSQVTTTTTTTTTETTTTERNTTPKSTAT 569

  Fly   155 ---------CPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCE 210
                     .|..|...........|:|.:|.||.:|:..:...:.||.||.|    |.....|.
  Fly   570 TTERTTTTVAPKTGICGGRNENENIAYPNNCTKYIVCVSPIPIAFFCPDGTFF----SSKLEKCI 630

  Fly   211 DPEDVPGCEDYYGDLDLKSIRKSELLAGLNSEGRTKGAPKTKAASSSS 258
            |..|...||   ||....::          ..|.|:..|:....::||
  Fly   631 DDWDESDCE---GDQSTTTL----------EPGYTRPPPEPTMCTNSS 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 10/50 (20%)
CBM_14 97..144 CDD:366726 11/60 (18%)
CBM_14 170..218 CDD:366726 15/47 (32%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884 11/55 (20%)
CBM_14 485..539 CDD:279884 12/66 (18%)
CBM_14 585..638 CDD:279884 15/56 (27%)
CBM_14 661..714 CDD:279884 2/5 (40%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.