DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG32302

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:247 Identity:47/247 - (19%)
Similarity:76/247 - (30%) Gaps:77/247 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FKCPDDFGFYPHDTSCDKYWKC-DNGVSELKTCGNGLAFD------------------------- 59
            |.| ...|.:|....|.:|.:| |..|...:.|.||..:.                         
  Fly    91 FSC-QQAGLFPDPYDCRRYHECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQEQFTCSRS 154

  Fly    60 ------ATDSKYL------TENCDYLHNVDCGDRTELEPPITTPHCSRLYGIFP---------DE 103
                  |.|::|.      |.|..|...:.|.:..........|....:..|..         |.
  Fly   155 GQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQAMESHTCMNNDR 219

  Fly   104 NKCDV------FWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANGFSCPAAGELA 162
            .:|..      :..|.:||.....|..|...|.....|: .|::.:|.:.|:   .|||      
  Fly   220 YQCPFRTSEIEYCKCVDGELEVMTCPAGFQIDPKILTCV-TDRIYQCSDFEI---LSCP------ 274

  Fly   163 NAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCEDPED 214
                   :...:|  :|.||::...:.|.||:|..|    :..|..|:...:
  Fly   275 -------NVSTKD--EYCICIDHQLQIYSCPMGQYF----NAETRKCQSESE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 17/88 (19%)
CBM_14 97..144 CDD:366726 11/61 (18%)
CBM_14 170..218 CDD:366726 11/45 (24%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.