DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG13806

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:216 Identity:53/216 - (24%)
Similarity:77/216 - (35%) Gaps:62/216 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QSSFKCPDDFGFYPHDTSCDKYWKC----DNGVSELKTCGNGLAFDATDSK---YLTENCDYLHN 75
            :.:|:|... |.:|....|.||..|    ...|:....|||..|||||..:   .||::......
  Fly    99 EGNFQCTSQ-GIFPDPYDCQKYHMCYFVGATLVAAAVDCGNDKAFDATTGQCTLTLTDSVCLQRQ 162

  Fly    76 VDCGDRTELEPPITTPHCSRLYGIFPDENKCDVFWNCWNG-----------EPSRYQCSPGLAY- 128
            ..|.:...:....|.|               ::|:.|.:.           .||.::|:.|..: 
  Fly   163 YYCPNAGHVAAWPTNP---------------NIFYVCKSTVNQNLNDTIVIYPSLHRCNDGETFV 212

  Fly   129 DRDARVCMWADQV--PECKNEEVA------NGFS-----CPAAGELANAGSFSRHAHPEDCRKYY 180
            |   .||.....|  |...:..|.      :.||     |...|.:|:.         .||||||
  Fly   213 D---YVCRSGSNVLPPSTDDPSVIIEDPNDDDFSVLPNTCQHVGLMADG---------NDCRKYY 265

  Fly   181 IC--LEGVAREYGCPIGTVFK 199
            .|  |.|..|...||.||.::
  Fly   266 YCSALNGTLRHMDCPNGTYYR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 19/57 (33%)
CBM_14 97..144 CDD:366726 11/60 (18%)
CBM_14 170..218 CDD:366726 14/32 (44%)
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 17/53 (32%)
ChtBD2 247..293 CDD:214696 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.