DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and obst-E

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:249 Identity:81/249 - (32%)
Similarity:114/249 - (45%) Gaps:26/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKFLV---VFVALFGAAVAQSSFKCPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATD 62
            |.|.|:   :.||:|| ::|..|.:||...|.:.....||.|.:|.:|....|.|.:||.|....
  Fly     1 MAKILISALLCVAMFG-SMALGSPECPTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRT 64

  Fly    63 SKYLTENCDYLHNVDCGDRTELEPPITTPHCSRLYGIFP--DENKCDVFWNCWNGEPSRYQCSPG 125
            .  .|..|.|.....|.:|..|:|...|..|.|.:|.:|  |..||.|:.||.:|..|..:|..|
  Fly    65 K--ATGECTYAPYSTCKERARLQPANGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEG 127

  Fly   126 LAYDRDARVCMWADQVPECKNEEVANGFSCPAAG----------ELANAGSFSRHAHPEDCRKYY 180
            ||::.:...|.|.|.|..| |.|...||:||||.          :::..|....:.||:.|:||:
  Fly   128 LAFNEETYQCDWPDLVESC-NAEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYF 191

  Fly   181 ICLEGVAREYGCPIGTVFKIGDSDGTGNCEDPEDVPGCEDYYGDLDLKSIRKSE 234
            :|:.|..|.|.|.....|    :..|..|:....||.|   |..|..|...|:|
  Fly   192 VCVNGHPRLYNCGKYLAF----NSQTKLCDFYNKVPEC---YALLKEKQRLKAE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 15/50 (30%)
CBM_14 97..144 CDD:366726 18/48 (38%)
CBM_14 170..218 CDD:366726 15/47 (32%)
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 13/41 (32%)
CBM_14 95..146 CDD:307643 19/50 (38%)
CBM_14 180..225 CDD:307643 15/48 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157817at2759
OrthoFinder 1 1.000 - - FOG0004529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.