DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and obst-A

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster


Alignment Length:243 Identity:89/243 - (36%)
Similarity:133/243 - (54%) Gaps:23/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKFL--VVFVALFGAAVAQSSFKCPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDS 63
            ||.||  :.........|:.::|:||...|.:..:..|||::.||:||::.|.|.:||.||..:.
  Fly     1 MKLFLCAIAVTLCVATTVSAANFECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNR 65

  Fly    64 KYLTENCDYLHNVDCGDRTELEPPITTPHCSRLYGIF--PDENKCDVFWNCWNGEPSRYQCSPGL 126
            |:  ..||...||||.|||||:.|.::.:|.|..|.|  ||...|::|:||..|:....:|:.||
  Fly    66 KF--NKCDQPFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGL 128

  Fly   127 AYDRDARVCMWADQV------PECKNEEVANGFSC----PAAGELANAGSFSRHAHPEDCRKYYI 181
            .:|..:..|:|.|..      ||.:..|  .||.|    |...:.....:..::.||.||:|:|:
  Fly   129 HFDEYSGTCVWPDTAKREGCNPEQRTSE--TGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYV 191

  Fly   182 CLEGV-AREYGCPIGTVFKIGDSDGTGNCEDPEDVPGCEDYYGDLDLK 228
            ||.|. .|:.||.:|.|:    :|.|..|:.||:||||||:|.|:|.|
  Fly   192 CLNGEDPRDLGCQLGEVY----NDATEMCDAPENVPGCEDWYKDVDDK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 19/50 (38%)
CBM_14 97..144 CDD:366726 17/54 (31%)
CBM_14 170..218 CDD:366726 21/48 (44%)
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 18/51 (35%)
CBM_14 95..143 CDD:366726 17/47 (36%)
CBM_14 180..225 CDD:366726 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444107
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157817at2759
OrthoFinder 1 1.000 - - FOG0004529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.