DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and Muc68E

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster


Alignment Length:191 Identity:50/191 - (26%)
Similarity:71/191 - (37%) Gaps:42/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFD------ATDSKYL---TENCDYLHNVDC 78
            |...:.:.||.|:|.||..|.||...:..|...|.:|      :.||...   |||.:....| |
  Fly  1626 CSTGYQYLPHPTNCHKYIHCSNGHELIMECPANLYWDYHKFVCSGDSGVCYNDTENSNPEEKV-C 1689

  Fly    79 GDRTELEPPITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPE 143
            |...:.   :..|            ..|.::..|.||.....:|...|.::.:.:.|.|:::.  
  Fly  1690 GPGVDF---LAHP------------TDCTMYLQCSNGVALERKCPDPLYWNPEIKSCDWSNKY-- 1737

  Fly   144 CKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYIC--LEGVARE-----YGCPIGTV 197
            |.|...:...|| |||  .|...|.     .||.||..|  |.||...     |..|:..|
  Fly  1738 CTNLRASQSISC-AAG--MNFNVFQ-----SDCSKYVKCFGLRGVVMSCNSGLYWNPVSQV 1790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 18/57 (32%)
CBM_14 97..144 CDD:366726 8/46 (17%)
CBM_14 170..218 CDD:366726 11/35 (31%)
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 11/30 (37%)
ChtBD2 1626..1668 CDD:214696 13/41 (32%)
ChtBD2 1688..1734 CDD:214696 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.