DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG33263

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_996072.1 Gene:CG33263 / 2768952 FlyBaseID:FBgn0053263 Length:227 Species:Drosophila melanogaster


Alignment Length:235 Identity:51/235 - (21%)
Similarity:70/235 - (29%) Gaps:85/235 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PHDT------SCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDY------LHNVDCGDRTE 83
            |.||      .|..|..|:...|...:|.....||..     |:.|.:      |.|.| ..:||
  Fly    32 PLDTFVMAIEDCASYIYCNGEDSFRDSCPESTYFDDR-----TQECAFDDEGVCLRNSD-SVQTE 90

  Fly    84 LEP----------------PITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLA----Y 128
            .:|                |:.||                         ||.| .|.|.|    :
  Fly    91 EQPDKQTTGEEQSGIEETTPVPTP-------------------------PSDY-ASTGSADSSTF 129

  Fly   129 DRDARVCMWADQVPECKNEEVANGF-SCPAAG-----------ELANAGSFSRHAHPEDCRKYYI 181
            ..|:.... .:.:|........:.. |.|:|.           :::..|.   |.||:.|..||.
  Fly   130 QADSTTTP-TESIPSVTEPPTTSATPSSPSAKPSSPAQERPHCDISGDGD---HPHPQRCEYYYR 190

  Fly   182 CLEGVAREYGCPIGTVFKIGDSDGTGNCEDPEDVPGCEDY 221
            ||.|......||    :|.|....|..|: |.....|..|
  Fly   191 CLSGYLTIVRCP----YKYGWDFPTKQCK-PSSEAQCFSY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 12/46 (26%)
CBM_14 97..144 CDD:366726 8/50 (16%)
CBM_14 170..218 CDD:366726 16/47 (34%)
CG33263NP_996072.1 CBM_14 28..79 CDD:279884 12/51 (24%)
CBM_14 171..222 CDD:279884 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.