DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and C39D10.7

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_509334.3 Gene:C39D10.7 / 181050 WormBaseID:WBGene00016534 Length:1171 Species:Caenorhabditis elegans


Alignment Length:307 Identity:71/307 - (23%)
Similarity:101/307 - (32%) Gaps:105/307 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VALFGAAVAQSSF-----------KCPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATD 62
            :::|.|||...|.           .|||..|.|....| .||.:|.|.|...::|..||.||.  
 Worm     4 LSIFAAAVILISADAKNVLNPKGPPCPDGDGLYAVGCS-SKYLQCVNNVEYEQSCPEGLYFDR-- 65

  Fly    63 SKYLTENCDYL---HNVDCGDRTEL---EPPITTPHCSRLYGIFP-DENKCDVFWNCWNGEPSRY 120
               |...|:..   |....|||..|   :..::.....||.|.:. |:..|:         .:.|
 Worm    66 ---LLARCERRSSNHLCATGDRVTLNVRQKAVSINCVGRLSGDYALDKTVCN---------ENYY 118

  Fly   121 QCSPGLAYDR----------------------------DARVCMWADQVPECKN--------EEV 149
            ||:.|::|.|                            |.....:|....:..|        |..
 Worm   119 QCANGISYMRKCPYQQVYVPILKRCDYHTNCNASGGVKDQAAAAYASPTYDSDNYIVTTKEFENG 183

  Fly   150 ANGFSCPAAGELANAGSFSRHAHPED---CRKYY-ICLEGVAREYGCPIGTVFKIGDSDGTGNCE 210
            .||..|...|::          |..|   |..|: .|..|......||...::.:..:    .|:
 Worm   184 HNGLDCKVTGDM----------HFTDNVKCSPYFWQCSNGKLFRKTCPEKLIYVLDQN----LCD 234

  Fly   211 DPEDVPGCEDYYGDLDLKSIRKSELLAGLNSEGRTKGAPKTKAASSS 257
            .||.|..|.:|.|                 ||...: ||||..:|||
 Worm   235 FPESVKDCPEYNG-----------------SETSYR-APKTTTSSSS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 18/61 (30%)
CBM_14 97..144 CDD:366726 11/75 (15%)
CBM_14 170..218 CDD:366726 12/51 (24%)
C39D10.7NP_509334.3 CBM_14 29..79 CDD:279884 19/55 (35%)
CBM_14 98..148 CDD:279884 11/58 (19%)
CBM_14 189..242 CDD:279884 14/66 (21%)
ChtBD2 337..384 CDD:214696
CBM_14 419..467 CDD:279884
CBM_14 560..612 CDD:279884
CBM_14 675..726 CDD:279884
CBM_14 774..825 CDD:279884
CBM_14 875..927 CDD:279884
CBM_14 941..992 CDD:279884
CBM_14 1010..1062 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.