DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and cbd-1

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_502145.2 Gene:cbd-1 / 178061 WormBaseID:WBGene00010351 Length:1319 Species:Caenorhabditis elegans


Alignment Length:216 Identity:52/216 - (24%)
Similarity:75/216 - (34%) Gaps:67/216 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KYWKCDNGVSELKTCGNGLAF--------------------DATDSKYLTEN-----CDYLHNVD 77
            ||.:|..|.|:|:.|.....|                    :.:..||.|.|     ||      
 Worm  1125 KYLRCSYGASKLQQCSEDRVFSNDKLECIVRESVSACTVPKNPSIKKYYTSNDQSAFCD------ 1183

  Fly    78 CGDRTELEPPITTPHCSRLYGIFPDENKCDVFWNCWNGE----PSRYQCSPGLAYDRDARVCMWA 138
                            .:..|::.:|..|.....|:.||    ||   |...||:::....|.:.
 Worm  1184 ----------------GKEDGLYRNERDCSAILQCFGGELFEHPS---CQSSLAFNQLTGKCDYP 1229

  Fly   139 DQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDS 203
            .:|..|:|....|       ||.:..|||...|:  :|..:|.|:.|......||.||||    :
 Worm  1230 QKVSGCENHGQTN-------GECSEHGSFIADAN--NCEVFYRCVWGRKVVMTCPSGTVF----N 1281

  Fly   204 DGTGNCEDPEDVPGCEDYYGD 224
            .....|:.|..||.|.....|
 Worm  1282 PLLSVCDWPSAVPSCSGQASD 1302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 13/58 (22%)
CBM_14 97..144 CDD:366726 13/50 (26%)
CBM_14 170..218 CDD:366726 15/47 (32%)
cbd-1NP_502145.2 ChtBD2 97..141 CDD:214696
ChtBD2 191..237 CDD:214696
CBM_14 692..743 CDD:307643
CBM_14 785..836 CDD:307643
CBM_14 1108..1161 CDD:307643 8/35 (23%)
CBM_14 1182..1235 CDD:307643 15/77 (19%)
CBM_14 1251..1296 CDD:307643 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.