DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and cpg-2

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_498551.3 Gene:cpg-2 / 175991 WormBaseID:WBGene00015102 Length:524 Species:Caenorhabditis elegans


Alignment Length:223 Identity:50/223 - (22%)
Similarity:72/223 - (32%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNV-DCGDRTELEPPITTP 91
            |.:|:......:..|..|::.:..|...|.|:.|   .|.  ||:..:| :|...     |...|
 Worm   253 GIHPNGVCSTNFLTCSGGIARIMDCPASLVFNPT---ILV--CDWPRDVAECAGL-----PTPQP 307

  Fly    92 HCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANGFSCP 156
            .|.. .|.|........|..|.||......|..||.:......|.:...|.||  :|.:...|..
 Worm   308 TCEE-DGYFSFGQCSSSFTACTNGRAIVMFCPAGLKFSESTVRCDYESNVSEC--QETSGEESGE 369

  Fly   157 AAGELANAGS--------------------------FSRHAHPEDCR-KYYICLEGVAREYGCPI 194
            |:||.:..||                          .....|...|. :...|..|....:.||.
 Worm   370 ASGEQSGEGSGEASGEASGESSGEGSGVEEQNQCVGLDNGLHAIGCSPRVLSCQNGHVDIFECPS 434

  Fly   195 GTVFKIGDSDGTGNCEDPEDVPGC--ED 220
            ..||    :|.:..|:.|:....|  ||
 Worm   435 SLVF----NDQSLICDYPQTSLKCLIED 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 10/43 (23%)
CBM_14 97..144 CDD:366726 11/46 (24%)
CBM_14 170..218 CDD:366726 11/48 (23%)
cpg-2NP_498551.3 CBM_14 24..76 CDD:279884
CBM_14 138..190 CDD:279884
ChtBD2 245..293 CDD:214696 11/44 (25%)
CBM_14 311..359 CDD:279884 11/48 (23%)
CBM_14 403..454 CDD:279884 11/54 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.