Sequence 1: | NP_649611.2 | Gene: | Gasp / 40745 | FlyBaseID: | FBgn0026077 | Length: | 258 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498171.1 | Gene: | R02F2.4 / 175755 | WormBaseID: | WBGene00019833 | Length: | 431 | Species: | Caenorhabditis elegans |
Alignment Length: | 267 | Identity: | 61/267 - (22%) |
---|---|---|---|
Similarity: | 91/267 - (34%) | Gaps: | 79/267 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 GFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNV-DCGDRTELEPPITTP 91
Fly 92 HCSRLYG----IFPD-----------ENKCDVFWN--------------CWNGEPSRYQCSPGLA 127
Fly 128 YDRDARVCMWADQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRK-YYICLEGVAREYG 191
Fly 192 CPIGTVFKIGDSDGTGNCEDPEDVPGCEDYYGDLDLKSIRKSEL------LAGLNSEGR------ 244
Fly 245 --TKGAP 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gasp | NP_649611.2 | ChtBD2 | 21..72 | CDD:214696 | 9/43 (21%) |
CBM_14 | 97..144 | CDD:366726 | 16/75 (21%) | ||
CBM_14 | 170..218 | CDD:366726 | 12/48 (25%) | ||
R02F2.4 | NP_498171.1 | CBM_14 | 25..74 | CDD:279884 | 11/47 (23%) |
ChtBD2 | 117..165 | CDD:214696 | 11/47 (23%) | ||
CBM_14 | 185..229 | CDD:279884 | 12/57 (21%) | ||
ChtBD2 | 240..283 | CDD:214696 | 7/24 (29%) | ||
CBM_14 | 310..361 | CDD:279884 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160157821 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |