DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and R02F2.4

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:267 Identity:61/267 - (22%)
Similarity:91/267 - (34%) Gaps:79/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNV-DCGDRTELEPPITTP 91
            |.||......::..|.:|.:....|...|.:...     .|.||:.||| :||:..| |...:..
 Worm    31 GMYPLGACEPRFLACVSGEARYMDCPEDLVYHKN-----LEFCDWRHNVFECGEEGE-ENEFSGD 89

  Fly    92 HCSRLYG----IFPD-----------ENKCDVFWN--------------CWNGEPSRYQCSPGLA 127
            ......|    .|.|           ||.|:...:              |.:|.|....||..|.
 Worm    90 GSGESSGDEEITFGDSSGESSGDELLENVCESLKDGVYSSGTCSSSYIICNSGSPRFLSCSTPLI 154

  Fly   128 YDRDARVCMWADQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRK-YYICLEGVAREYG 191
            ||...:.|.|...:.||..   .:|..|.:.|.::.:          :|.. ::.|.||:|....
 Worm   155 YDPTNKKCSWKGMIDECSQ---VSGEYCESDGNISKS----------ECSNVFFSCSEGIAHRRN 206

  Fly   192 CPIGTVFKIGDSDGTGNCEDPEDVPGCEDYYGDLDLKSIRKSEL------LAGLNSEGR------ 244
            ||...||    :....:|:.|::|..|.:           |||.      :.|..|.||      
 Worm   207 CPANLVF----NPAISSCDWPKNVMDCSE-----------KSEKPQNCGEVDGYFSFGRCSSSFS 256

  Fly   245 --TKGAP 249
              |.|.|
 Worm   257 ACTNGIP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 9/43 (21%)
CBM_14 97..144 CDD:366726 16/75 (21%)
CBM_14 170..218 CDD:366726 12/48 (25%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884 11/47 (23%)
ChtBD2 117..165 CDD:214696 11/47 (23%)
CBM_14 185..229 CDD:279884 12/57 (21%)
ChtBD2 240..283 CDD:214696 7/24 (29%)
CBM_14 310..361 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.