DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and cpg-1

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001021159.1 Gene:cpg-1 / 175586 WormBaseID:WBGene00000465 Length:584 Species:Caenorhabditis elegans


Alignment Length:310 Identity:60/310 - (19%)
Similarity:85/310 - (27%) Gaps:141/310 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVALFGAAVAQSSFKCPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDY 72
            ||:...|....:.....:| |.|.......::..|..|:|.:..|...|.:|..     ...|:|
 Worm    48 FVSGADAVAIDTDCSTKED-GLYAIGGCSPQFLTCSGGISRIMDCPADLIYDPR-----IVACEY 106

  Fly    73 LHNV-DCG---------------DRTELEP---------------------------PI-----T 89
            .:|| .||               :.|.:.|                           |:     |
 Worm   107 SYNVPQCGGVPQDVTSTQEAYPSEETTVNPYAPVEEATTTPAEDVTVPEETTTEAYAPVDDYSTT 171

  Fly    90 TP----------HCSRLYGIFP--------DE------------NKCDVFWN----------CWN 114
            ||          ..|....|.|        ||            .|.|.|::          |.|
 Worm   172 TPAEDVPVPVETTASPYAPIVPYTTGAPAADEPVTRSAVTKSCVGKADGFYSFGECSDHYTACSN 236

  Fly   115 GEPSRYQCSPGLAYDRDARVCMWADQVPECKN-----EEVANGFSCPAAGELANAGSFSRHAHPE 174
            |.....||...||:|....:|.:...||||.|     |..|:..:..::||:..           
 Worm   237 GYLIPMQCPARLAFDEARVICDYVMNVPECTNGSGNDEGSADETTPESSGEMPY----------- 290

  Fly   175 DCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCED---PEDVPGCEDY 221
                                        |:|.|..|.   .||||..:||
 Worm   291 ----------------------------SNGYGYEETTTVAEDVPSTKDY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 10/50 (20%)
CBM_14 97..144 CDD:366726 18/76 (24%)
CBM_14 170..218 CDD:366726 8/50 (16%)
cpg-1NP_001021159.1 CBM_14 61..113 CDD:279884 13/57 (23%)
CBM_14 214..266 CDD:279884 14/51 (27%)
CBM_14 <537..576 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.