Sequence 1: | NP_649611.2 | Gene: | Gasp / 40745 | FlyBaseID: | FBgn0026077 | Length: | 258 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001021159.1 | Gene: | cpg-1 / 175586 | WormBaseID: | WBGene00000465 | Length: | 584 | Species: | Caenorhabditis elegans |
Alignment Length: | 310 | Identity: | 60/310 - (19%) |
---|---|---|---|
Similarity: | 85/310 - (27%) | Gaps: | 141/310 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 FVALFGAAVAQSSFKCPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDY 72
Fly 73 LHNV-DCG---------------DRTELEP---------------------------PI-----T 89
Fly 90 TP----------HCSRLYGIFP--------DE------------NKCDVFWN----------CWN 114
Fly 115 GEPSRYQCSPGLAYDRDARVCMWADQVPECKN-----EEVANGFSCPAAGELANAGSFSRHAHPE 174
Fly 175 DCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCED---PEDVPGCEDY 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gasp | NP_649611.2 | ChtBD2 | 21..72 | CDD:214696 | 10/50 (20%) |
CBM_14 | 97..144 | CDD:366726 | 18/76 (24%) | ||
CBM_14 | 170..218 | CDD:366726 | 8/50 (16%) | ||
cpg-1 | NP_001021159.1 | CBM_14 | 61..113 | CDD:279884 | 13/57 (23%) |
CBM_14 | 214..266 | CDD:279884 | 14/51 (27%) | ||
CBM_14 | <537..576 | CDD:279884 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160157820 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |