DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CTSF

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_003784.2 Gene:CTSF / 8722 HGNCID:2531 Length:484 Species:Homo sapiens


Alignment Length:306 Identity:90/306 - (29%)
Similarity:152/306 - (49%) Gaps:34/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YNKQYRNRDK--------YHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD-TDQRILFNYR 92
            ||:.|.::::        .:..:..|::.|::.....|         |:.|||| |::.....|.
Human   194 YNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGTAQY---------GVTKFSDLTEEEFRTIYL 249

  Fly    93 SSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMA 157
            :::......:.....::|.    |......|||..|.::.|.|||. |.||||||.:|.:|....
Human   250 NTLLRKEPGNKMKQAKSVG----DLAPPEWDWRSKGAVTKVKDQGM-CGSCWAFSVTGNVEGQWF 309

  Fly   158 KKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRD-HGIATKESYPYEPVSGECLWKSDRS 221
            ...|.|:.||.:.|:|| ...:..|.||..|.|::..:: .|:.|::.|.|:.....|.:.::::
Human   310 LNQGTLLSLSEQELLDC-DKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKA 373

  Fly   222 AGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLS--IPACRSKRQDLTHSV 284
            ...::..|.| :.:|::||..:...||::|:|:....:|  |..|:..  .|.|.....|  |:|
Human   374 KVYINDSVEL-SQNEQKLAAWLAKRGPISVAINAFGMQF--YRHGISRPLRPLCSPWLID--HAV 433

  Fly   285 LLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCGVASL 330
            ||||:| :|....:|.||||:||||||.||..|.| .:..|||.::
Human   434 LLVGYG-NRSDVPFWAIKNSWGTDWGEKGYYYLHR-GSGACGVNTM 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 12/56 (21%)
Peptidase_C1A 120..334 CDD:239068 75/214 (35%)
CTSFNP_003784.2 Inhibitor_I29 187..243 CDD:214853 12/57 (21%)
Peptidase_C1 271..482 CDD:278538 75/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149666
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.