DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and RD21A

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_564497.1 Gene:RD21A / 841122 AraportID:AT1G47128 Length:462 Species:Arabidopsis thaliana


Alignment Length:322 Identity:110/322 - (34%)
Similarity:172/322 - (53%) Gaps:37/322 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WDQYKAKYNK-QYRNR--DKYHR-ALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD--TDQRIL 88
            ::.:..|:.| |.:|.  :|..| .:::..:..|:.||:..|    ::::||.:|:|  .|:   
plant    50 YEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEKNL----SYRLGLTRFADLTNDE--- 107

  Fly    89 FNYRSS-IPAPLETSTNALTETVNYKRY-----DQITEGIDWRQYGYISPVGDQGTECLSCWAFS 147
              |||. :.|.:|......|..    ||     |::.|.||||:.|.::.|.||| .|.||||||
plant   108 --YRSKYLGAKMEKKGERRTSL----RYEARVGDELPESIDWRKKGAVAEVKDQG-GCGSCWAFS 165

  Fly   148 TSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNY-TRDHGIATKESYPYEPVS 211
            |.|.:|.......|:|:.||.:.||||....|.||:||.:..||.: .::.||.|.:.|||:.|.
plant   166 TIGAVEGINQIVTGDLITLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDTDKDYPYKGVD 230

  Fly   212 GEC-LWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRS 275
            |.| ..:.:....|:..|..:..|.|..|.:.|.: .|::::|:.....|..|..|:.. .:|.:
plant   231 GTCDQIRKNAKVVTIDSYEDVPTYSEESLKKAVAH-QPISIAIEAGGRAFQLYDSGIFD-GSCGT 293

  Fly   276 KRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARN---ANNMCGVASLPQYP 334
            :   |.|.|:.||:|| ....||||::||:|..|||||||::|||   ::..||:|..|.||
plant   294 Q---LDHGVVAVGYGT-ENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGIAIEPSYP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 14/60 (23%)
Peptidase_C1A 120..334 CDD:239068 84/218 (39%)
RD21ANP_564497.1 Inhibitor_I29 50..107 CDD:214853 14/60 (23%)
Peptidase_C1 137..352 CDD:395062 86/222 (39%)
GRAN 376..432 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.