DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and AT1G29110

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_564322.1 Gene:AT1G29110 / 839786 AraportID:AT1G29110 Length:334 Species:Arabidopsis thaliana


Alignment Length:323 Identity:93/323 - (28%)
Similarity:162/323 - (50%) Gaps:46/323 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QYKAKYNKQYRNRDKYHRAL--YEQRVLAVESHNQLYLQGKVAFKMGLNKFSD--TDQRILFNYR 92
            |:..::::.|::..:....|  :::.:..:|:.|.:   |..::.:|:|:|:|  |::.:     
plant    40 QWMTQFSRVYKDESEKEMRLKVFKKNLKFIENFNNM---GNQSYTLGVNEFTDWKTEEFL----- 96

  Fly    93 SSIPAPLETSTNALTETVNYKR---------YDQITEGIDWRQYGYISPVGDQGTECLSCWAFST 148
             :....|..:..:|:|..|..:         .|...|..|||..|.::||..||    :|.....
plant    97 -ATHTGLRVNVTSLSELFNKTKPSRNWNMSDIDMEDESKDWRDEGAVTPVKYQG----ACRLTKI 156

  Fly   149 SGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNY-TRDHGIATKESYPYEPVSG 212
            ||          .||:.||.:.|:||....|.||:||....||.| .::.|::.:..|||:....
plant   157 SG----------KNLLTLSEQQLIDCDIEKNGGCNGGEFEEAFKYIIKNGGVSLETEYPYQVKKE 211

  Fly   213 ECLWKSDRSAGT-LSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSK 276
            .|...:.|:..| :.|:..:.:::||.|.|.|.. .||:|.||...:.|..|.|||.:...|.: 
plant   212 SCRANARRAPHTQIRGFQMVPSHNERALLEAVRR-QPVSVLIDARADSFGHYKGGVYAGLDCGT- 274

  Fly   277 RQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNA---NNMCGVASLPQYPTF 336
              |:.|:|.:||:|| ....:||::|||:|..|||:||:::.|:.   ..|||:|.:..||.|
plant   275 --DVNHAVTIVGYGT-MSGLNYWVLKNSWGESWGENGYMRIRRDVEWPQGMCGIAQVAAYPVF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 11/56 (20%)
Peptidase_C1A 120..334 CDD:239068 74/218 (34%)
AT1G29110NP_564322.1 Inhibitor_I29 38..95 CDD:285458 11/57 (19%)
Peptidase_C1 132..333 CDD:278538 75/219 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.