DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and AT1G29080

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_564320.1 Gene:AT1G29080 / 839783 AraportID:AT1G29080 Length:346 Species:Arabidopsis thaliana


Alignment Length:311 Identity:110/311 - (35%)
Similarity:161/311 - (51%) Gaps:25/311 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKAKYNKQYRNRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD-TDQRILFNYRS--- 93
            |..::.||.|.:      :..:.:..:||.|.:   |..::|:|:|:|:| |.:..|..|..   
plant    50 YDDEFEKQLRLQ------VLTENLKFIESFNNM---GNQSYKLGVNEFTDWTKEEFLATYTGLRG 105

  Fly    94 -SIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMA 157
             ::.:|.|. .|......|:...|.:....|||..|.::||..|| ||..|||||....:|....
plant   106 VNVTSPFEV-VNETKPAWNWTVSDVLGTNKDWRNEGAVTPVKSQG-ECGGCWAFSAIAAVEGLTK 168

  Fly   158 KKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDH-GIATKESYPYEPVSGECLWKSDRS 221
            ...|||:.||.:.|:||....||||.||....||||...| ||:::..|||:...|.|. .:.|.
plant   169 IARGNLISLSEQQLLDCTREQNNGCKGGTFVNAFNYIIKHRGISSENEYPYQVKEGPCR-SNARP 232

  Fly   222 AGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLL 286
            |..:.|:..:.:.:||.|.|.| :..||||:||.....|..|||||.:...|.:   .:.|:|.|
plant   233 AILIRGFENVPSNNERALLEAV-SRQPVAVAIDASEAGFVHYSGGVYNARNCGT---SVNHAVTL 293

  Fly   287 VGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNA---NNMCGVASLPQYP 334
            ||:||..:...||:.|||:|..|||:||:::.|:.   ..|||||....||
plant   294 VGYGTSPEGMKYWLAKNSWGKTWGENGYIRIRRDVEWPQGMCGVAQYASYP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 14/52 (27%)
Peptidase_C1A 120..334 CDD:239068 87/217 (40%)
AT1G29080NP_564320.1 PTZ00203 4..328 CDD:185513 103/293 (35%)
Inhibitor_I29 39..95 CDD:214853 14/53 (26%)
Peptidase_C1 135..345 CDD:278538 89/216 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.