DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and XBCP3

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_563855.1 Gene:XBCP3 / 837517 AraportID:AT1G09850 Length:437 Species:Arabidopsis thaliana


Alignment Length:340 Identity:105/340 - (30%)
Similarity:174/340 - (51%) Gaps:43/340 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLVELGLTAVSDTE-WDQYKAKYNKQYRNRDKYHRALYEQRVLAVESHNQLYLQGKV----AFK 74
            ||||....::...:| :|.:..|:.|.|.:.::     .:||:...:.::....|..:    .:.
plant    16 LLLVSSSSSSDDISELFDDWCQKHGKTYGSEEE-----RQQRIQIFKDNHDFVTQHNLITNATYS 75

  Fly    75 MGLNKFSDTDQRILFNYRS-----SIPAP---LETSTNALTETVNYKRYDQITEGIDWRQYGYIS 131
            :.||.|:|....   .:::     |:.||   :.:...:|..:|      ::.:.:|||:.|.::
plant    76 LSLNAFADLTHH---EFKASRLGLSVSAPSVIMASKGQSLGGSV------KVPDSVDWRKKGAVT 131

  Fly   132 PVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYT-R 195
            .|.|||: |.:||:||.:|.:|.......|:|:.||.:.|:||....|.||:||.:..||.:. :
plant   132 NVKDQGS-CGACWSFSATGAMEGINQIVTGDLISLSEQELIDCDKSYNAGCNGGLMDYAFEFVIK 195

  Fly   196 DHGIATKESYPYEPVSGECLWKSDR---SAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLH 257
            :|||.|::.|||:...|.|  |.|:   ...|:..|..:.:.||:.|.|.| ...||:|.|....
plant   196 NHGIDTEKDYPYQERDGTC--KKDKLKQKVVTIDSYAGVKSNDEKALMEAV-AAQPVSVGICGSE 257

  Fly   258 EEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNAN 322
            ..|..||.|:.|.|...|    |.|:||:||:|: :...||||:|||:|..||..|::.:.||..
plant   258 RAFQLYSSGIFSGPCSTS----LDHAVLIVGYGS-QNGVDYWIVKNSWGKSWGMDGFMHMQRNTE 317

  Fly   323 N---MCGVASLPQYP 334
            |   :||:..|..||
plant   318 NSDGVCGINMLASYP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 11/58 (19%)
Peptidase_C1A 120..334 CDD:239068 82/220 (37%)
XBCP3NP_563855.1 Inhibitor_I29 32..89 CDD:285458 11/64 (17%)
Peptidase_C1 118..333 CDD:278538 84/224 (38%)
GRAN 351..407 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.