DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and AT1G06260

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_563764.1 Gene:AT1G06260 / 837137 AraportID:AT1G06260 Length:343 Species:Arabidopsis thaliana


Alignment Length:351 Identity:113/351 - (32%)
Similarity:174/351 - (49%) Gaps:52/351 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LILLLLVELGLTAVSDTEWDQYKA----------KYNKQYRNRDKY--HRALYEQRVLAVESHNQ 64
            ||..:|:...|.:|..:.:|.:|.          .::|.|..||::  ...:|:..|..::..|.
plant    15 LICFVLIASKLCSVDSSVYDPHKTLKQRFEKWLKTHSKLYGGRDEWMLRFGIYQSNVQLIDYINS 79

  Fly    65 LYLQGKVAFKMGLNKFSD-TDQRILFNYRSSIPAPLETSTNALTETVNYKRY-------DQITEG 121
            |:|    .||:..|:|:| |:.....::..     |.||:..|     :|:.       ..:.:.
plant    80 LHL----PFKLTDNRFADMTNSEFKAHFLG-----LNTSSLRL-----HKKQRPVCDPAGNVPDA 130

  Fly   122 IDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDC-VPYPNNGCSGG 185
            :|||..|.::|:.:|| :|..|||||....:|.....|.||||.||.:.|:|| |...|.|||||
plant   131 VDWRTQGAVTPIRNQG-KCGGCWAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGG 194

  Fly   186 WVSVAFNYTRDH-GIATKESYPYEPVSGEC-LWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGP 248
            .:..||.:.:.: |:||:..|||..:.|.| ..||.....|:.||..:.. :|..| ::.....|
plant   195 LMETAFEFIKTNGGLATETDYPYTGIEGTCDQEKSKNKVVTIQGYQKVAQ-NEASL-QIAAAQQP 257

  Fly   249 VAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGD--YWIIKNSYGTDWGE 311
            |:|.||.....|..||.||.: ..|.:   :|.|.|.:||:|..   ||  |||:|||:||.|||
plant   258 VSVGIDAGGFIFQLYSSGVFT-NYCGT---NLNHGVTVVGYGVE---GDQKYWIVKNSWGTGWGE 315

  Fly   312 SGYLKLARNAN---NMCGVASLPQYP 334
            .||:::.|..:   ..||:|.:..||
plant   316 EGYIRMERGVSEDTGKCGIAMMASYP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 17/67 (25%)
Peptidase_C1A 120..334 CDD:239068 84/221 (38%)
AT1G06260NP_563764.1 Inhibitor_I29 43..98 CDD:214853 15/58 (26%)
Peptidase_C1 127..341 CDD:365882 84/223 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.