DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and SAG12

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_568651.1 Gene:SAG12 / 834629 AraportID:AT5G45890 Length:346 Species:Arabidopsis thaliana


Alignment Length:324 Identity:102/324 - (31%)
Similarity:172/324 - (53%) Gaps:35/324 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EWDQYKAKYNKQYRN-RDKYHR-ALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD--TDQ-RIL 88
            ||   ..|:.:.|.: :::.:| .:::..|..:|..|.: ..|: .||:.:|:|:|  .|: |.:
plant    40 EW---MTKHGRVYADVKEENNRYVVFKNNVERIEHLNSI-PAGR-TFKLAVNQFADLTNDEFRSM 99

  Fly    89 FNYRSSIPAPLETSTNALTETVNYKRYDQITEG-----IDWRQYGYISPVGDQGTECLSCWAFST 148
            :.....:.|   .|:.:.|:...: ||..::.|     :|||:.|.::|:.:||: |..|||||.
plant   100 YTGFKGVSA---LSSQSQTKMSPF-RYQNVSSGALPVSVDWRKKGAVTPIKNQGS-CGCCWAFSA 159

  Fly   149 SGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNN--GCSGGWVSVAFNYTR-DHGIATKESYPYEPV 210
            ...:|.....|.|.|:.||.:.||||   ..|  ||.||.:..||.:.: ..|:.|:.:|||:..
plant   160 VAAIEGATQIKKGKLISLSEQQLVDC---DTNDFGCEGGLMDTAFEHIKATGGLTTESNYPYKGE 221

  Fly   211 SGEC-LWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACR 274
            ...| ..|::..|.:::||..:...||:.|.:.|.: .||:|.|:....:|..||.||.: ..|.
plant   222 DATCNSKKTNPKATSITGYEDVPVNDEQALMKAVAH-QPVSVGIEGGGFDFQFYSSGVFT-GECT 284

  Fly   275 SKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANN---MCGVASLPQYPT 335
            :.   |.|:|..:|:|.......|||||||:||.||||||:::.::..:   :||:|....|||
plant   285 TY---LDHAVTAIGYGESTNGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCGLAMKASYPT 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 13/58 (22%)
Peptidase_C1A 120..334 CDD:239068 78/225 (35%)
SAG12NP_568651.1 Inhibitor_I29 38..95 CDD:214853 14/59 (24%)
Peptidase_C1 130..345 CDD:395062 78/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.