DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and XCP1

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_567983.1 Gene:XCP1 / 829688 AraportID:AT4G35350 Length:355 Species:Arabidopsis thaliana


Alignment Length:314 Identity:97/314 - (30%)
Similarity:164/314 - (52%) Gaps:20/314 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WDQYKAKYNKQYRN-RDKYHR-ALYEQRVLAVESHNQLYLQGKV-AFKMGLNKFSDTDQRILFNY 91
            ::.:.::::|.|:: .:|.|| .::.:.::.::..|     .:: ::.:|||:|:|.........
plant    51 FESWMSEHSKAYKSVEEKVHRFEVFRENLMHIDQRN-----NEINSYWLGLNEFADLTHEEFKGR 110

  Fly    92 RSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHM 156
            ...:..|..:.....:....|:....:.:.:|||:.|.::||.||| :|.|||||||...:|...
plant   111 YLGLAKPQFSRKRQPSANFRYRDITDLPKSVDWRKKGAVAPVKDQG-QCGSCWAFSTVAAVEGIN 174

  Fly   157 AKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNY-TRDHGIATKESYPYEPVSGECL-WKSD 219
            ....|||..||.:.|:||....|:||:||.:..||.| ....|:..::.|||....|.|. .|.|
plant   175 QITTGNLSSLSEQELIDCDTTFNSGCNGGLMDYAFQYIISTGGLHKEDDYPYLMEEGICQEQKED 239

  Fly   220 RSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSV 284
            ....|:|||..:...|:..|.:.:.: .||:|:|:....:|..|.|||.: ..|.:   ||.|.|
plant   240 VERVTISGYEDVPENDDESLVKALAH-QPVSVAIEASGRDFQFYKGGVFN-GKCGT---DLDHGV 299

  Fly   285 LLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNA---NNMCGVASLPQYPT 335
            ..||:|: .|..||.|:|||:|..|||.|::::.||.   ..:||:..:..|||
plant   300 AAVGYGS-SKGSDYVIVKNSWGPRWGEKGFIRMKRNTGKPEGLCGINKMASYPT 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 11/57 (19%)
Peptidase_C1A 120..334 CDD:239068 81/218 (37%)
XCP1NP_567983.1 Inhibitor_I29 51..106 CDD:214853 11/59 (19%)
Peptidase_C1 137..352 CDD:395062 82/221 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.