DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and AT4G23520

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_567686.2 Gene:AT4G23520 / 828452 AraportID:AT4G23520 Length:356 Species:Arabidopsis thaliana


Alignment Length:361 Identity:116/361 - (32%)
Similarity:182/361 - (50%) Gaps:62/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILLLLVELGLTAVSDTE-------------------WDQYKAKYNKQYRNR--DKYHR-ALYEQR 55
            ||.||:...|:|.|...                   :..:.:|:.|.|.|.  :|..| ..::..
plant    11 ILFLLIVFVLSAPSSAMDLPATSGGHNRSNEEVEFIFQMWMSKHGKTYTNALGEKERRFQNFKDN 75

  Fly    56 VLAVESHNQLYLQGKVAFKMGLNKFSDTDQRILFNYRSSIP-APLETSTNALTETVNYKRY---- 115
            :..::.||...|    ::::||.:|:|...:   .||...| :|.....|..|.    :||    
plant    76 LRFIDQHNAKNL----SYQLGLTRFADLTVQ---EYRDLFPGSPKPKQRNLKTS----RRYVPLA 129

  Fly   116 -DQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPN 179
             ||:.|.:||||.|.:|.:.|||| |.|||||||...:|.......|.|:.||.:.|||| ...|
plant   130 GDQLPESVDWRQEGAVSEIKDQGT-CNSCWAFSTVAAVEGLNKIVTGELISLSEQELVDC-NLVN 192

  Fly   180 NGCSG-GWVSVAFNY-TRDHGIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNY------DE 236
            |||.| |.:..||.: ..::|:.:::.|||:...|.|    :|...|.:..:|:.:|      ||
plant   193 NGCYGSGLMDTAFQFLINNNGLDSEKDYPYQGTQGSC----NRKQSTSNKVITIDSYEDVPANDE 253

  Fly   237 RELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWII 301
            ..|.:.|.: .||:|.:|...:||..|...:.:.| |.:   :|.|::::||:|: ....||||:
plant   254 ISLQKAVAH-QPVSVGVDKKSQEFMLYRSCIYNGP-CGT---NLDHALVIVGYGS-ENGQDYWIV 312

  Fly   302 KNSYGTDWGESGYLKLARN---ANNMCGVASLPQYP 334
            :||:||.||::||:|:|||   ...:||:|.|..||
plant   313 RNSWGTTWGDAGYIKIARNFEDPKGLCGIAMLASYP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 13/57 (23%)
Peptidase_C1A 120..334 CDD:239068 84/224 (38%)
AT4G23520NP_567686.2 Inhibitor_I29 47..103 CDD:214853 13/62 (21%)
Peptidase_C1 133..349 CDD:278538 86/228 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.