DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and AT4G11320

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001328659.1 Gene:AT4G11320 / 826734 AraportID:AT4G11320 Length:371 Species:Arabidopsis thaliana


Alignment Length:333 Identity:112/333 - (33%)
Similarity:164/333 - (49%) Gaps:44/333 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VSDTE----WDQYKAKYNKQYRNRDKYHRAL--YEQRVLAVESHNQLYLQGKVAFKMGLNKFSDT 83
            :.|.|    ::.:..|:.|.|.:..:..|.|  :|..:..:.:.|    ...:::::|||:|:|.
plant    47 IFDAEATLMFESWMVKHGKVYDSVAEKERRLTIFEDNLRFITNRN----AENLSYRLGLNRFADL 107

  Fly    84 DQRILFNY----RSSIPAP-----LETSTNALTETVNYKRY--DQITEGIDWRQYGYISPVGDQG 137
            .   |..|    ..:.|.|     ..||:|      .||..  |.:.:.:|||..|.::.|.|||
plant   108 S---LHEYGEICHGADPRPPRNHVFMTSSN------RYKTSDGDVLPKSVDWRNEGAVTEVKDQG 163

  Fly   138 TECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDH-GIAT 201
            . |.|||||||.|.:|.......|.||.||.:.|::| ...||||.||.|..|:.:..:: |:.|
plant   164 L-CRSCWAFSTVGAVEGLNKIVTGELVTLSEQDLINC-NKENNGCGGGKVETAYEFIMNNGGLGT 226

  Fly   202 KESYPYEPVSGEC--LWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYS 264
            ...|||:.::|.|  ..|.|.....:.||..|...||..|.:.|.: .||...:|....||..|.
plant   227 DNDYPYKALNGVCEGRLKEDNKNVMIDGYENLPANDEAALMKAVAH-QPVTAVVDSSSREFQLYE 290

  Fly   265 GGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANN---MCG 326
            .||.. ..|.:   :|.|.|::||:|| ....||||:|||.|..|||:||:|:|||..|   :||
plant   291 SGVFD-GTCGT---NLNHGVVVVGYGT-ENGRDYWIVKNSRGDTWGEAGYMKMARNIANPRGLCG 350

  Fly   327 VASLPQYP 334
            :|....||
plant   351 IAMRASYP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 12/56 (21%)
Peptidase_C1A 120..334 CDD:239068 86/219 (39%)
AT4G11320NP_001328659.1 Inhibitor_I29 56..111 CDD:214853 13/61 (21%)
Peptidase_C1 144..359 CDD:278538 88/223 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.980

Return to query results.
Submit another query.