DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and AT3G49340

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_566920.1 Gene:AT3G49340 / 824096 AraportID:AT3G49340 Length:341 Species:Arabidopsis thaliana


Alignment Length:351 Identity:119/351 - (33%)
Similarity:191/351 - (54%) Gaps:37/351 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVVHGLILLLLVEL--------GLTAVSDTE-WDQYKAKYNKQYR-NRDKYHR-ALYEQRVLAVE 60
            ::|..|:.:||...        ||...|..| .:|:.:::|:.|. :.:|..| .::...:..||
plant     3 SIVFFLLAILLSSRTSGVTSRGGLFEASAVEKHEQWMSRFNRVYSDDSEKTSRFEIFTNNLKFVE 67

  Fly    61 SHNQLYLQGKVAFKMGLNKFSD-TDQRILFNYRSSIPAP---LETSTNALTETVNYKRYDQI--- 118
            |.|   :.....:.:.:|:||| ||:.....| :.:..|   ...||....|||:: ||:.:   
plant    68 SIN---MNTNKTYTLDVNEFSDLTDEEFKARY-TGLVVPEGMTRISTTDSHETVSF-RYENVGET 127

  Fly   119 TEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCS 183
            .|.:||.|.|.::.|..| .:|..|||||....:|.......|.||.||.:.|:|| ...||||.
plant   128 GESMDWIQEGAVTSVKHQ-QQCGCCWAFSAVAAVEGMTKIANGELVSLSEQQLLDC-STENNGCG 190

  Fly   184 GGWVSVAFNYTRDH-GIATKESYPYEPVSGECLWKSDR-SAGTLSGYVTLGNYDERELAEVVYNI 246
            ||.:..||:|.::: ||.|:::|||:.....|  :|:. :|.|:|||.|:...||..|.:.| :.
plant   191 GGIMWKAFDYIKENQGITTEDNYPYQGAQQTC--ESNHLAAATISGYETVPQNDEEALLKAV-SQ 252

  Fly   247 GPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGE 311
            .||:|:|:....||..||||:.: ..|.::   |||:|.:||:|...:...||::|||:|..|||
plant   253 QPVSVAIEGSGYEFIHYSGGIFN-GECGTQ---LTHAVTIVGYGVSEEGIKYWLLKNSWGESWGE 313

  Fly   312 SGYLKLARNANN---MCGVASLPQYP 334
            :||:::.|:.::   |||:|||..||
plant   314 NGYMRIMRDVDSPQGMCGLASLAYYP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 14/57 (25%)
Peptidase_C1A 120..334 CDD:239068 85/218 (39%)
AT3G49340NP_566920.1 Inhibitor_I29 35..92 CDD:400519 15/59 (25%)
Peptidase_C1 129..340 CDD:395062 87/220 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.