DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and AT3G19400

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_566634.2 Gene:AT3G19400 / 821474 AraportID:AT3G19400 Length:362 Species:Arabidopsis thaliana


Alignment Length:360 Identity:118/360 - (32%)
Similarity:184/360 - (51%) Gaps:42/360 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPRLTVVHGLILL--LLVELGLTAVSDTE-----------WDQYKAKYNKQYRNRDKYHR--ALY 52
            ||...:|..|::|  ||:...|...::||           ::|:..:..|.|....:..|  .::
plant     4 TPIRVIVSALVILSVLLLSSSLGVATETEIERNETEVRLMYEQWLVENRKNYNGLGEKERRFKIF 68

  Fly    53 EQRVLAVESHNQLYLQGKVAFKMGLNKFSD-TDQRILFNY-RSSIPAPLETSTNALTETVNYKRY 115
            :..:..|:.||.:   ....|::||.:|:| |::.....| |..:.   .|..:..||...||..
plant    69 KDNLKFVDEHNSV---PDRTFEVGLTRFADLTNEEFRAIYLRKKME---RTKDSVKTERYLYKEG 127

  Fly   116 DQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDC-VPYPN 179
            |.:.:.:|||..|.:..|.||| .|.||||||..|.:|.......|.|:.||.:.|||| ..:.|
plant   128 DVLPDEVDWRANGAVVSVKDQG-NCGSCWAFSAVGAVEGINQITTGELISLSEQELVDCDRGFVN 191

  Fly   180 NGCSGGWVSVAFNY-TRDHGIATKESYPYEPVS-GECLWKSDRSAG----TLSGYVTLGNYDERE 238
            .||.||.::.||.: .::.||.|.:.|||.... |.|  .:|::..    |:.||..:...||:.
plant   192 AGCDGGIMNYAFEFIMKNGGIETDQDYPYNANDLGLC--NADKNNNTRVVTIDGYEDVPRDDEKS 254

  Fly   239 LAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKN 303
            |.:.|.: .||:|:|:...:.|..|..||:: ..|..   .|.|.|::||:|: ....|||||:|
plant   255 LKKAVAH-QPVSVAIEASSQAFQLYKSGVMT-GTCGI---SLDHGVVVVGYGS-TSGEDYWIIRN 313

  Fly   304 SYGTDWGESGYLKLARNANN---MCGVASLPQYPT 335
            |:|.:||:|||:||.||.::   .||:|.:|.|||
plant   314 SWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYPT 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 13/57 (23%)
Peptidase_C1A 120..334 CDD:239068 84/223 (38%)
AT3G19400NP_566634.2 Inhibitor_I29 44..100 CDD:214853 13/58 (22%)
Peptidase_C1 130..348 CDD:395062 85/226 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.