DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and AT3G19390

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_566633.1 Gene:AT3G19390 / 821473 AraportID:AT3G19390 Length:452 Species:Arabidopsis thaliana


Alignment Length:361 Identity:121/361 - (33%)
Similarity:186/361 - (51%) Gaps:42/361 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGTPRLTVVHGLIL--LLLVELGLTAVSDTEWDQYKAKYNKQY-----RNRDKYHR--------A 50
            |.|...::...|::  :||:.|.|.:|:.||..:.:|:..:.|     .||..|:.        .
plant     1 MATSIKSITLALLIFSVLLISLSLGSVTATETTRNEAEARRMYERWLVENRKNYNGLGEKERRFE 65

  Fly    51 LYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD--TDQRILFNYRSSIPAPLETSTNALTETVNYK 113
            :::..:..||.|:.:   ....:::||.:|:|  .|:......||.:.   .|......|...||
plant    66 IFKDNLKFVEEHSSI---PNRTYEVGLTRFADLTNDEFRAIYLRSKME---RTRVPVKGEKYLYK 124

  Fly   114 RYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYP 178
            ..|.:.:.||||..|.::||.|||: |.||||||..|.:|.....|.|.|:.||.:.||||....
plant   125 VGDSLPDAIDWRAKGAVNPVKDQGS-CGSCWAFSAIGAVEGINQIKTGELISLSEQELVDCDTSY 188

  Fly   179 NNGCSGGWVSVAFNYTRDH-GIATKESYPYEPVS-GECLWKSDRS---AGTLSGYVTLGNYDERE 238
            |:||.||.:..||.:..:: ||.|:|.|||.... ..|  .||:.   ..|:.||..:...||:.
plant   189 NDGCGGGLMDYAFKFIIENGGIDTEEDYPYIATDVNVC--NSDKKNTRVVTIDGYEDVPQNDEKS 251

  Fly   239 LAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWG-DYWIIK 302
            |.:.:.| .|::|:|:.....|..|:.||.: ..|.:   .|.|.|:.||:|:  :.| ||||::
plant   252 LKKALAN-QPISVAIEAGGRAFQLYTSGVFT-GTCGT---SLDHGVVAVGYGS--EGGQDYWIVR 309

  Fly   303 NSYGTDWGESGYLKLARN---ANNMCGVASLPQYPT 335
            ||:|::||||||.||.||   ::..||||.:..|||
plant   310 NSWGSNWGESGYFKLERNIKESSGKCGVAMMASYPT 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 12/69 (17%)
Peptidase_C1A 120..334 CDD:239068 88/222 (40%)
AT3G19390NP_566633.1 Inhibitor_I29 43..99 CDD:214853 11/58 (19%)
Peptidase_C1 129..345 CDD:278538 89/225 (40%)
GRAN 364..420 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.