DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and AT2G27420

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_565649.1 Gene:AT2G27420 / 817287 AraportID:AT2G27420 Length:348 Species:Arabidopsis thaliana


Alignment Length:324 Identity:111/324 - (34%)
Similarity:178/324 - (54%) Gaps:33/324 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DQYKAKYNKQY----RNRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD-TDQRILFN 90
            :|:.|::|:.|    ..|::::  ::::.:..|::.|   :..|:.:|:.:|:||| ||:.....
plant    36 EQWMARFNRVYSDETEKRNRFN--IFKKNLEFVQNFN---MNNKITYKVDINEFSDLTDEEFRAT 95

  Fly    91 YRSSIPAPLETSTNALT---ETVNYKRYDQIT---EGIDWRQYGYISPVGDQGTECLSCWAFSTS 149
            :...:.....|..:.|:   .||.: ||..::   |.:||||.|.::||..|| .|..|||||..
plant    96 HTGLVVPEAITRISTLSSGKNTVPF-RYGNVSDNGESMDWRQEGAVTPVKYQG-RCGGCWAFSAV 158

  Fly   150 GVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNY-TRDHGIATKESYPYEPVSGE 213
            ..:|.......|.||.||.:.|:||....|.||.||.:|.||.| .::.||.|:::|||:.....
plant   159 AAVEGITKITKGELVSLSEQQLLDCDRDYNQGCRGGIMSKAFEYIIKNQGITTEDNYPYQESQQT 223

  Fly   214 C-----LWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPAC 273
            |     |..|.|:| |:|||.|:...:|..|.:.| :..||:|.|:.....|..|||||.: ..|
plant   224 CSSSTTLSSSFRAA-TISGYETVPMNNEEALLQAV-SQQPVSVGIEGTGAAFRHYSGGVFN-GEC 285

  Fly   274 RSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNAN---NMCGVASLPQYP 334
            .:   ||.|:|.:||:|...:...||::|||:|..|||:||:::.|:.:   .|||:|.|..||
plant   286 GT---DLHHAVTIVGYGMSEEGTKYWVVKNSWGETWGENGYMRIKRDVDAPQGMCGLAILAFYP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 14/58 (24%)
Peptidase_C1A 120..334 CDD:239068 88/222 (40%)
AT2G27420NP_565649.1 Inhibitor_I29 35..91 CDD:214853 15/59 (25%)
Peptidase_C1 130..347 CDD:278538 90/224 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.