DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and ctsw

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001039033.1 Gene:ctsw / 733785 XenbaseID:XB-GENE-963153 Length:303 Species:Xenopus tropicalis


Alignment Length:305 Identity:88/305 - (28%)
Similarity:144/305 - (47%) Gaps:32/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KYNKQYRNRDKYHRALYEQRVLA--VESHNQLYLQGKVAFKMGLNKFSD-TDQRILFNYRSSIPA 97
            :||:.|:.|:::.   |..|:.:  ::..::|..:.....:.|:.|||| ||:.....:   :| 
 Frog     3 QYNRSYKTREEFK---YRLRIFSENLKEASRLQREELGTAQYGVTKFSDLTDEEFSIYH---LP- 60

  Fly    98 PLETSTNALTETVNYKRYDQI---TEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKK 159
                 ||.|......|:.:::   ....|||....||...:|.| |.|||||:....:||..| .
 Frog    61 -----TNILPTPPILKQSEEVLPFPTSCDWRTQNVISKAKNQRT-CHSCWAFAAVANIEAQWA-I 118

  Fly   160 YGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAF-NYTRDHGIATKESYPYEPVSGECLWKSDRSAG 223
            .|..:.||.:.::||... .||||||:...|| ...:..|:.:::||||......|. |...:.|
 Frog   119 LGQTISLSEQQVIDCNTC-RNGCSGGYAWDAFMTVLQQGGLTSEKSYPYTGHVSNCR-KGFEAVG 181

  Fly   224 TLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVG 288
            .:..:..| ..:|..:|..|.:.|.:.|:|:  ......|..|::...........:.|.||:||
 Frog   182 WIHDFEML-KKNETAMASHVAHKGTLTVTIN--KAPLKHYQKGIVDTLRSNCDPNYVDHVVLIVG 243

  Fly   289 FGTHRKWG--DYWIIKNSYGTDWGESGYLKLARNANNMCGVASLP 331
            :   |..|  ..||:|||:|.||||.|:.::.|: .|.||:...|
 Frog   244 Y---RGGGKLPQWILKNSWGEDWGEKGFFRMFRD-KNACGITKYP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 13/51 (25%)
Peptidase_C1A 120..334 CDD:239068 69/215 (32%)
ctswNP_001039033.1 Inhibitor_I29 1..53 CDD:214853 14/52 (27%)
Peptidase_C1A 80..285 CDD:239068 69/216 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.