DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsll3

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_081620.2 Gene:Ctsll3 / 70202 MGIID:1917452 Length:331 Species:Mus musculus


Alignment Length:333 Identity:126/333 - (37%)
Similarity:184/333 - (55%) Gaps:19/333 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLVELGLTAVS---------DTEWDQYKAKYNKQYRNRDK-YHRALYEQRVLAVESHNQLYLQ 68
            :.||..|.|..||         |..|:::|.|:.|.|...|: ..||::|.....::.||:.||:
Mouse     4 VFLLATLCLGVVSAAPAHNPSLDAVWEEWKTKHKKTYNMNDEGQKRAVWENNKKMIDLHNEDYLK 68

  Fly    69 GKVAFKMGLNKFSDTDQRILFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPV 133
            ||..|.:.:|.|.|....   .:|..:.......|..:.:.........:.:.:|||.:||::||
Mouse    69 GKHGFSLEMNAFGDLTNT---EFRELMTGFQGQKTKMMMKVFQEPLLGDVPKSVDWRDHGYVTPV 130

  Fly   134 GDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCV-PYPNNGCSGGWVSVAFNYTRDH 197
            .|||: |.||||||..|.||..|.:|.|.|||||.::||||. ...|.||.||...:||.|.:|:
Mouse   131 KDQGS-CGSCWAFSAVGSLEGQMFRKTGKLVPLSVQNLVDCSWSQGNQGCDGGLPDLAFQYVKDN 194

  Fly   198 -GIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFD 261
             |:.|..|||||.::|.|.:....||.|::|:|.:.: .|..|.:.|..:||::|.||..|:.|.
Mouse   195 GGLDTSVSYPYEALNGTCRYNPKNSAATVTGFVNVQS-SEDALMKAVATVGPISVGIDTKHKSFQ 258

  Fly   262 QYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCG 326
            .|..|:...|.|.|...|  |:||:||:|.......||::|||:|.|||.:||:|:|::.||.||
Mouse   259 FYKEGMYYEPDCSSTVLD--HAVLVVGYGEESDGRKYWLVKNSWGRDWGMNGYIKMAKDRNNNCG 321

  Fly   327 VASLPQYP 334
            :||...||
Mouse   322 IASDASYP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 19/55 (35%)
Peptidase_C1A 120..334 CDD:239068 96/215 (45%)
Ctsll3NP_081620.2 PTZ00203 7..330 CDD:185513 125/330 (38%)
Inhibitor_I29 29..87 CDD:214853 19/60 (32%)
Peptidase_C1 115..330 CDD:278538 98/219 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.