DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctso

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_038959660.1 Gene:Ctso / 684529 RGDID:1589156 Length:311 Species:Rattus norvegicus


Alignment Length:343 Identity:96/343 - (27%)
Similarity:148/343 - (43%) Gaps:73/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LILLLLVELGLTAVSDTEWD-QYKAKYNKQYRNRDKYHRALYEQRVLAVESHNQLYLQGKVAFKM 75
            |:||....||........|. |.:|...::..||   ||.|           |........|| .
  Rat     8 LLLLCCCCLGRGVARTWPWSPQREAAALRESLNR---HRYL-----------NSFPHDNSTAF-Y 57

  Fly    76 GLNKFSDTDQRILFN------YRSSIPA-----PLETSTNALTETVNYKRYDQITEGIDWRQYGY 129
            |:|:||     .||.      |..|.||     |.:..|.....::..:        .|||....
  Rat    58 GVNQFS-----YLFPEEFKALYLGSKPAWAPRYPAKGQTPIPNVSLPLR--------FDWRDKHV 109

  Fly   130 ISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGG-------WV 187
            ::.|.:|.| |..|||||....:|:..|.:...|..||.:.::|| .:.|.||.||       |:
  Rat   110 VNHVRNQKT-CGGCWAFSVVSAVESAGAIQGKPLDYLSVQQVIDC-SFNNYGCRGGSPLGALSWL 172

  Fly   188 SVAFNYTRDHGIATKESYPYEPVSGECLWKSDRSAG-TLSGYVTLGNYD----ERELAEVVYNIG 247
                |.|:...:|..: ||::..:|.|.:.....:| ::.|:   ..||    |.|:|..:.:.|
  Rat   173 ----NETQLKLVADSQ-YPFKAENGLCRYFPPSQSGVSVKGF---SAYDFSNQEDEMARALLSFG 229

  Fly   248 PVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGD--YWIIKNSYGTDWG 310
            |:.|.:|.:  .:..|.||::. ..|.|  .:..|:||:.||.   |.|:  ||:::||:|..||
  Rat   230 PLVVIVDAV--SWQDYLGGIIQ-HHCSS--GEANHAVLITGFD---KTGNTPYWMVRNSWGNSWG 286

  Fly   311 ESGYLKLARNANNMCGVA 328
            ..|| ...:...|:||:|
  Rat   287 VEGY-AYVKMGGNVCGIA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 15/55 (27%)
Peptidase_C1A 120..334 CDD:239068 68/223 (30%)
CtsoXP_038959660.1 Peptidase_C1A 99..304 CDD:239068 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.