DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL3 and Ctsb

DIOPT Version :10

Sequence 1:NP_649608.1 Gene:CtsL3 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_072119.2 Gene:Ctsb / 64529 RGDID:621509 Length:339 Species:Rattus norvegicus


Alignment Length:277 Identity:74/277 - (26%)
Similarity:119/277 - (42%) Gaps:74/277 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LTETVNYKRYDQITEGID----WRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKY-----G 161
            |.|.|.:.....:.|..|    |.....|:.:.|||: |.|||||   |.:|| |:.:.     |
  Rat    68 LPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGS-CGSCWAF---GAVEA-MSDRICIHTNG 127

  Fly   162 NL-VPLSPKHLVDCVPYP-NNGCSGGWVSVAFNYTRDHGIATKESY-------PY---------- 207
            .: |.:|.:.|:.|.... .:||:||:.|.|:|:....|:.:...|       ||          
  Rat   128 RVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVN 192

  Fly   208 ---EPVSGE---------C------LWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSID 254
               .|.:||         |      .:|.|:..|..|..|   :..|:|:...:|..|||..:..
  Rat   193 GSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSV---SDSEKEIMAEIYKNGPVEGAFT 254

  Fly   255 HLHEEFDQYSGGVLSIPACRSKRQDLT--HSVLLVGFGTHRKWG-----DYWIIKNSYGTDWGES 312
             :..:|..|..||.     :.:..|:.  |::.::|      ||     .||::.||:..|||::
  Rat   255 -VFSDFLTYKSGVY-----KHEAGDVMGGHAIRILG------WGIENGVPYWLVANSWNVDWGDN 307

  Fly   313 GYLKLARNANNMCGVAS 329
            |:.|:.|..|: ||:.|
  Rat   308 GFFKILRGENH-CGIES 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL3NP_649608.1 Inhibitor_I29 30..85 CDD:462410
Peptidase_C1A 120..334 CDD:239068 71/263 (27%)
CtsbNP_072119.2 Peptidase_C1A_CathepsinB 81..328 CDD:239111 71/264 (27%)
Propeptide_C1 26..65 CDD:462365
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.