DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and ctsbb

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_005160989.1 Gene:ctsbb / 569298 ZFINID:ZDB-GENE-070323-1 Length:331 Species:Danio rerio


Alignment Length:284 Identity:75/284 - (26%)
Similarity:122/284 - (42%) Gaps:78/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LTETVNYKRYDQITEGID----WRQYGYISPVGDQGTECLSCWAF-STSGVLEAHMAKKYGNLVP 165
            |..||.:....::.:..|    |.....::.:.|||: |.||||| :...:.:.......|...|
Zfish    68 LPHTVKHSTNVKLPDSFDLRDQWPNCKTLNQIRDQGS-CGSCWAFGAVESISDRICIHSKGKQSP 131

  Fly   166 -LSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIATKESY-------PYE-------------P 209
             :|.:.|:.|......|||||:.:.|::|.|..|:.|...|       ||.             |
Zfish   132 EISAEDLLSCCDQCGFGCSGGFPAEAWDYWRRSGLVTGGLYNSDVGCRPYSIAPCEHHVNGTRPP 196

  Fly   210 VSGE---------CL------WKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEE 259
            .|||         |:      :|.|:..|:....|.   .|::::...:|..|||..:.. ::|:
Zfish   197 CSGEQDTPKCTGVCIPKYSVPYKQDKHFGSKVYNVP---SDQQQIMTELYTNGPVEAAFT-VYED 257

  Fly   260 FDQYSGGVLSIPACRSKRQDLT------HSVLLVGFGTHRKWGD-----YWIIKNSYGTDWGESG 313
            |..|..||.         |.||      |:|.::|      ||:     :|::.||:.:|||::|
Zfish   258 FPLYKSGVY---------QHLTGSALGGHAVKILG------WGEENGTPFWLVANSWNSDWGDNG 307

  Fly   314 YLKLARNANNMCG-----VASLPQ 332
            |.|:.| .::.||     ||.||:
Zfish   308 YFKILR-GHDECGIESEMVAGLPK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 72/270 (27%)
ctsbbXP_005160989.1 Propeptide_C1 28..65 CDD:285358
Peptidase_C1A_CathepsinB 81..327 CDD:239111 69/266 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.