DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsr

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_064680.1 Gene:Ctsr / 56835 MGIID:1861723 Length:334 Species:Mus musculus


Alignment Length:341 Identity:126/341 - (36%)
Similarity:185/341 - (54%) Gaps:24/341 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVHGLILLLLVELGLTAVS---DTEWDQYKAKYNKQYR-NRDKYHRALYEQRVLAVESHNQLYLQ 68
            ||....|.|.|..|:..:.   |.||..:|.||||.|. ..:|..|.::|:::..::.||:....
Mouse     4 VVFIAFLYLGVASGVPVLDSSLDAEWQDWKIKYNKSYSLKEEKLKRVVWEEKLKMIKLHNRENSL 68

  Fly    69 GKVAFKMGLNKFSD-TDQRILFNYRSSIPAPLETSTNALTETVNYKRYDQ---ITEGIDWRQYGY 129
            ||..|.|.:|:|.| ||:    .:|..:   :|.|.....|..:..:.:.   :.:.:|||:.||
Mouse    69 GKNGFTMKMNEFGDQTDE----EFRKMM---IEISVWTHREGKSIMKREAGSILPKFVDWRKKGY 126

  Fly   130 ISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDC-VPYPNNGCSGGWVSVAFNY 193
            ::||..|| :|.:||||:.:|.:||....:.|.|.|||.::|||| .|..||||.||....||.|
Mouse   127 VTPVRRQG-DCDACWAFAVTGAIEAQAIWQTGKLTPLSVQNLVDCSKPQGNNGCLGGDTYNAFQY 190

  Fly   194 T-RDHGIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLH 257
            . .:.|:.::.:||||...|.|.:....|...::|:|:|...::..:|.|. .|||:...||..|
Mouse   191 VLHNGGLESEATYPYEGKDGPCRYNPKNSKAEITGFVSLPQSEDILMAAVA-TIGPITAGIDASH 254

  Fly   258 EEFDQYSGGVLSIPACRSKRQDLTHSVLLVGF---GTHRKWGDYWIIKNSYGTDWGESGYLKLAR 319
            |.|..|.||:...|.|.|  ..:||.||:||:   |.......||:||||:|..||..||:|||:
Mouse   255 ESFKNYKGGIYHEPNCSS--DTVTHGVLVVGYGFKGIETDGNHYWLIKNSWGKRWGIRGYMKLAK 317

  Fly   320 NANNMCGVASLPQYPT 335
            :.||.||:||...|||
Mouse   318 DKNNHCGIASYAHYPT 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 20/56 (36%)
Peptidase_C1A 120..334 CDD:239068 90/218 (41%)
CtsrNP_064680.1 PTZ00203 15..332 CDD:185513 118/327 (36%)
Inhibitor_I29 29..87 CDD:214853 21/61 (34%)
Peptidase_C1A 116..332 CDD:239068 90/219 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.