DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and MGC174155

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001096588.1 Gene:MGC174155 / 564906 -ID:- Length:335 Species:Danio rerio


Alignment Length:360 Identity:117/360 - (32%)
Similarity:185/360 - (51%) Gaps:64/360 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LILLLLVELGLTAV---------SDTEWDQYKAKYNKQY-RNRDKYHRALYEQRVLAVESHNQLY 66
            ::..|||.|.::||         .|..|:.:|:::.|.| .:.:...|.::|:.:..:|.||..|
Zfish     1 MMFALLVTLCISAVFAASSIDIQLDDHWNSWKSQHGKSYHEDVEVGRRMIWEENLRKIEQHNFEY 65

  Fly    67 LQGKVAFKMGLNKFSD-------------------TDQRILFNYRSSIPAPLETSTNALTETVNY 112
            ..|...||||:|:|.|                   |.|..||...|...||              
Zfish    66 SYGNHTFKMGMNQFGDMTNEEFRQAMNGYKHDPNRTSQGPLFMEPSFFAAP-------------- 116

  Fly   113 KRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCV-P 176
                   :.:||||.||::||.|| .:|.|||:||::|.||..:.:|.|.|:.:|.::||||. |
Zfish   117 -------QQVDWRQRGYVTPVKDQ-KQCGSCWSFSSTGALEGQLFRKTGKLISMSEQNLVDCSRP 173

  Fly   177 YPNNGCSGGWVSVAFNYTRDH-GIATKESYPYEPVSG-ECLWKSDRSAGTLSGYVTLGNYDEREL 239
            ..|.||:||.:..||.|.::: |:.:::||||..... .|.:....:...::|:|.:...:|..|
Zfish   174 QGNQGCNGGIMDQAFQYVKENKGLDSEQSYPYLARDDLPCRYDPRFNVAKITGFVDIPRGNELAL 238

  Fly   240 AEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGD-----YW 299
            ...|..:|||:|:||..|:....|..|:....||.|:   |.|:||:||:|  .:..|     ||
Zfish   239 MNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACTSR---LDHAVLVVGYG--YQGADVAGNRYW 298

  Fly   300 IIKNSYGTDWGESGYLKLARNANNMCGVASLPQYP 334
            |:|||:...||:.||:.:|::.||.||:|::..||
Zfish   299 IVKNSWSDKWGDKGYIYMAKDKNNHCGIATMASYP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 19/74 (26%)
Peptidase_C1A 120..334 CDD:239068 83/221 (38%)
MGC174155NP_001096588.1 Inhibitor_I29 28..86 CDD:214853 18/57 (32%)
Peptidase_C1 115..334 CDD:278538 87/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.