DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctss

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_059016.2 Gene:Ctss / 50654 RGDID:621513 Length:341 Species:Rattus norvegicus


Alignment Length:322 Identity:115/322 - (35%)
Similarity:172/322 - (53%) Gaps:30/322 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DTEWDQYKAKYNKQYR--NRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSDTDQRILF 89
            |..||.:|..:.|:|:  |.:...|.::|:.:..:..||..:..|..::.:|:|...|.....:.
  Rat    34 DHHWDLWKKTHEKEYKDQNEEDVRRLIWEKNLKFIMLHNLEHSMGMHSYSVGMNHMGDMTPEEVI 98

  Fly    90 NYRSSIPAP--------LETSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAF 146
            .|..|:..|        |::|:|           ..:.:.:|||:.|.::.|..||: |.|||||
  Rat    99 GYMGSLRIPRHWNRSGTLKSSSN-----------QTLPDSVDWREKGCVTNVKYQGS-CGSCWAF 151

  Fly   147 STSGVLEAHMAKKYGNLVPLSPKHLVDC---VPYPNNGCSGGWVSVAFNYTRDH-GIATKESYPY 207
            |..|.||..:..|.|.||.||.::||||   ..|.|.||.||:::.||.|..|: ||.::.||||
  Rat   152 SAVGALEGQLKLKTGKLVSLSAQNLVDCSTEEKYGNKGCGGGFMTEAFQYIIDNGGIDSEASYPY 216

  Fly   208 EPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPA 272
            :.:..:|.:.....|.|.|.|:.|...||..|.|.|...|||:|.||..|..|..|..||...|:
  Rat   217 KAMDEKCHYDPKNRAATCSRYIELPFGDEEALKEAVATKGPVSVGIDASHSSFFLYQSGVYDDPS 281

  Fly   273 CRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCGVASLPQYP 334
            |   .:::.|.||:||:|| ....|||::|||:|..:|:.||:::|||..|.||:||...||
  Rat   282 C---TENVNHGVLVVGYGT-LDGKDYWLVKNSWGLHFGDQGYIRMARNNKNHCGIASYCSYP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 14/56 (25%)
Peptidase_C1A 120..334 CDD:239068 92/217 (42%)
CtssNP_059016.2 Inhibitor_I29 37..96 CDD:214853 14/58 (24%)
Peptidase_C1 124..339 CDD:395062 92/219 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.