DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL3 and Ctla2a

DIOPT Version :10

Sequence 1:NP_649608.1 Gene:CtsL3 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001102585.1 Gene:Ctla2a / 498690 RGDID:1565540 Length:113 Species:Rattus norvegicus


Alignment Length:91 Identity:32/91 - (35%)
Similarity:51/91 - (56%) Gaps:12/91 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DTEWDQYKAKYNKQYR-NRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD-TDQRILF 89
            ||||:::|.|:.|.|. :.:::.||::|:....:|:||..|.|||.:|.||||:||| |.:....
  Rat    13 DTEWEEWKKKFGKTYSPDEERHRRAVWEESKKTIEAHNADYKQGKTSFYMGLNQFSDLTTEEFRR 77

  Fly    90 NYRSS----------IPAPLETSTNA 105
            |...|          :|.|.:...|:
  Rat    78 NCCGSLMCRGKTTHDLPIPEDLGKNS 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL3NP_649608.1 Inhibitor_I29 30..85 CDD:462410 24/56 (43%)
Peptidase_C1A 120..334 CDD:239068
Ctla2aNP_001102585.1 Inhibitor_I29 16..74 CDD:214853 24/57 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.