DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and MGC114246

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001017509.1 Gene:MGC114246 / 498688 RGDID:1562210 Length:334 Species:Rattus norvegicus


Alignment Length:344 Identity:126/344 - (36%)
Similarity:186/344 - (54%) Gaps:23/344 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPRLTVVHGLILLLLVELG---LTAVSDTEWDQYKAKYNKQYR-NRDKYHRALYEQRVLAVESHN 63
            ||.:.:.   ||.|.|..|   |....|.||.::|.||:|.|. ..::..||::|:.:..::.||
  Rat     2 TPAVFIA---ILCLGVASGAPILDPSLDAEWQEWKKKYDKSYSLEEEELRRAVWEENLKMIKLHN 63

  Fly    64 QLYLQGKVAFKMGLNKFSDTDQRILFNYRS-SIPAPLETSTNALTETVNYKRYDQI-TEGIDWRQ 126
            .....||..|.|.:|:|.||...   .:|. .:..|::|....  :::..:....| .:.:|||:
  Rat    64 GENGLGKNGFTMEINEFGDTTGE---EFRKMMVEFPVQTHREG--KSIMKRAAGSIFPKFVDWRK 123

  Fly   127 YGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDC-VPYPNNGCSGGWVSVA 190
            .||::||..|| .|.:|||||.:|.:||....:.|.|:|||.::|||| .|..||||.||....|
  Rat   124 KGYVTPVRRQG-NCNACWAFSVTGAIEAQTIWQSGKLIPLSVQNLVDCSKPQGNNGCLGGDTYNA 187

  Fly   191 FNYT-RDHGIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSID 254
            |.|. .:.|:.::.:||||...|.|.:....|:..::|:|:|.. .|..|...|..|||::..||
  Rat   188 FQYVLHNGGLQSEATYPYEGKDGPCRYNPKNSSAEITGFVSLPE-SEDILMVAVATIGPISAGID 251

  Fly   255 HLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFG--THRKWGD-YWIIKNSYGTDWGESGYLK 316
            ..||.|..|..|:...|.|.|  ..:||.||:||:|  .:...|| ||:||||:|..||..||:|
  Rat   252 ASHESFKFYKKGIYHEPNCSS--NSVTHGVLVVGYGFKGNDTGGDHYWLIKNSWGKQWGIRGYMK 314

  Fly   317 LARNANNMCGVASLPQYPT 335
            :.::.||.|.:||...|||
  Rat   315 ITKDKNNHCAIASYAHYPT 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 19/55 (35%)
Peptidase_C1A 120..334 CDD:239068 90/218 (41%)
MGC114246NP_001017509.1 PTZ00203 7..332 CDD:185513 121/336 (36%)
Inhibitor_I29 29..87 CDD:214853 19/60 (32%)
Peptidase_C1A 116..332 CDD:239068 90/219 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.