DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and ctsh

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_031753756.1 Gene:ctsh / 496748 XenbaseID:XB-GENE-5820392 Length:330 Species:Xenopus tropicalis


Alignment Length:348 Identity:120/348 - (34%)
Similarity:173/348 - (49%) Gaps:55/348 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLVELGLTAVSDTEWDQYKAKYNKQYRNRDK--YHRALYEQRVLAVESHNQLYLQGKVAFKMGL 77
            ::::....:.:.|.||:.:|.||.|:|.:.:.  :.|..:|.....|..||||..||...:.|.:
 Frog    10 IIVMSASASNLLDEEWNTWKEKYEKKYASSEDELFRRKAWEVNWDKVTKHNQLADQGLKKYTMAM 74

  Fly    78 NKFSD-TDQRILFNYRSSI----------PAPLETSTNALTETVNYKRYD----QITEGIDWRQY 127
            |.|:| |.:.:  |.|:..          |||               ||:    :|::|:|||..
 Frog    75 NHFADMTSEEM--NSRNCFLPTHYPSKHKPAP---------------RYNVKHAKISKGVDWRDS 122

  Fly   128 GYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFN 192
            ..||||.:|| .|.|||||:|.|||||........|..||.:.||||.|. ::||.||:...|.:
 Frog   123 NCISPVKNQG-YCGSCWAFATVGVLEALHCLNGNELHNLSEQQLVDCDPI-DHGCCGGFPINAID 185

  Fly   193 YTRDHGIATKESYPYEPVSGECLWKSDRSAG-TLSGYVTLGNYDERELAEVVYNIGPVAVSIDHL 256
            |....||...|.|.||.....|.:.|..:.. .:|.|..|.|  |..:|..|...||:.|... :
 Frog   186 YITQEGIMKSEDYEYEEKQFYCRYDSSNAIQLNVSKYYVLPN--EENMASSVAKDGPITVGFG-V 247

  Fly   257 HEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGT-HRKWG-----DYWIIKNSYGTDWGESGYL 315
            :.:|..||.|:.. ..|..:.   .|::::||:|| |.:.|     ||||||||:||:|||.|:.
 Frog   248 NRDFMLYSKGIFD-GECAPRP---NHAIIIVGYGTLHCEEGKDDGEDYWIIKNSWGTEWGEDGFG 308

  Fly   316 KLARNANNMCGV----ASLPQYP 334
            |:.|| .:|||:    |||...|
 Frog   309 KIMRN-KDMCGISEFAASLELKP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 20/57 (35%)
Peptidase_C1A 120..334 CDD:239068 89/224 (40%)
ctshXP_031753756.1 Inhibitor_I29 25..84 CDD:214853 20/58 (34%)
Peptidase_C1A 117..324 CDD:239068 85/216 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.