powered by:
Protein Alignment CG11459 and zgc:103438
DIOPT Version :9
Sequence 1: | NP_001287191.1 |
Gene: | CG11459 / 40741 |
FlyBaseID: | FBgn0037396 |
Length: | 336 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001006036.1 |
Gene: | zgc:103438 / 450015 |
ZFINID: | ZDB-GENE-041010-131 |
Length: | 311 |
Species: | Danio rerio |
Alignment Length: | 52 |
Identity: | 14/52 - (26%) |
Similarity: | 30/52 - (57%) |
Gaps: | 6/52 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 YKAKYNKQYRNRDKYHR--ALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD 82
:|.|:|:||::..::.: .::...:..|.|.|::.| :|.:|:|..||
Zfish 254 FKEKFNQQYKSEKEHEKREIIFVHTLRFVHSRNRVGL----SFSLGINDRSD 301
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1275401at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.