DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsql2

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001002813.2 Gene:Ctsql2 / 408201 RGDID:1303225 Length:343 Species:Rattus norvegicus


Alignment Length:344 Identity:116/344 - (33%)
Similarity:181/344 - (52%) Gaps:31/344 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LILLLLVELGLTAVS---DTEWDQYKAKYNKQYRNRDK-YHRALYEQRVLAVESHNQLYLQGKVA 72
            :||.|.|..|.:|.:   |.:|.::|.||.|.|...:: ..|.::|:.|..:|.||:....||..
  Rat     8 IILCLGVVSGASAFNLSLDVQWQEWKMKYEKLYSPEEELLKRVVWEENVKKIELHNRENSLGKNT 72

  Fly    73 FKMGLNKFSDTDQRILFNYRSSIPAPLETSTNALTETVNYKR------------YDQITEGIDWR 125
            :.|.:|.|:|.......:..:.|..|:..:..:|     :||            .|.:.:.||||
  Rat    73 YIMEINNFADLTDEEFKDMITGITLPINNTMKSL-----WKRALGSPFPNSWYWRDALPKSIDWR 132

  Fly   126 QYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDC-VPYPNNGCSGGWVSV 189
            :.||::.|.:|| :|.|||||..:|.:|..|.||.|.|.|||.::|||| .|..|.||.||....
  Rat   133 KEGYVTRVREQG-KCKSCWAFPVAGAIEGQMFKKTGKLTPLSVQNLVDCSKPQGNKGCRGGTTYN 196

  Fly   190 AFNYT-RDHGIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSI 253
            ||.|. ::.|:.::.:|||:...|.|.:....:...::.:|.|.. ||..|.:.:...||||..|
  Rat   197 AFQYVLQNGGLESEATYPYKGKEGLCKYNPKNAYAKITRFVALPE-DEDVLMDALATKGPVAAGI 260

  Fly   254 DHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGF---GTHRKWGDYWIIKNSYGTDWGESGYL 315
            ..::.....|..|:...|.|.::   :.|:||:||:   |......:||:||||:|..||..||:
  Rat   261 HVVYSSLRFYKKGIYHEPKCNNR---VNHAVLVVGYGFEGNETDGNNYWLIKNSWGKQWGLKGYM 322

  Fly   316 KLARNANNMCGVASLPQYP 334
            |:|::.||.||:|:..|||
  Rat   323 KIAKDRNNHCGIATFAQYP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 18/55 (33%)
Peptidase_C1A 120..334 CDD:239068 83/218 (38%)
Ctsql2NP_001002813.2 Inhibitor_I29 29..87 CDD:214853 18/57 (32%)
Peptidase_C1 125..342 CDD:278538 85/222 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.