DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and ctsc

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_012812143.2 Gene:ctsc / 407938 XenbaseID:XB-GENE-940480 Length:458 Species:Xenopus tropicalis


Alignment Length:250 Identity:79/250 - (31%)
Similarity:128/250 - (51%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PAPLETSTNALTETVNYKRYDQITEGIDWRQ---YGYISPVGDQGTECLSCWAFSTSGVLEA--H 155
            ||||.|.          ::|..:....|||.   |.:::||.:|.: |.||:|||:.|:||:  .
 Frog   214 PAPLPTD----------EKYQGLPTEWDWRNIAGYNFVTPVRNQAS-CGSCYAFSSMGMLESRIQ 267

  Fly   156 MAKKYGNLVPLSPKHLVDCVPYPNNGCSGGW-VSVAFNYTRDHGIATKESYPYEPVSGECLWKSD 219
            :..:......|||:.:|.|..| :.||.||: ..:|..|..|:||..:...||......|..|..
 Frog   268 IRSQLSQKPILSPQQVVSCSNY-SQGCEGGFPYLIAGKYVSDYGIVEESDLPYTGSDSPCTLKDS 331

  Fly   220 RSAGTLSGYVTLGNY----DEREL-AEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSK--- 276
            :.....:.|..:|.:    :|..: .|:|.. ||::|:.: ::::|..|..||......:.|   
 Frog   332 QQKYYTAEYHYVGGFYGGCNEAYMKLELVLG-GPLSVAFE-VYDDFMHYRSGVYHHTGLQDKFNP 394

  Fly   277 RQDLTHSVLLVGFGTHRKWGD-YWIIKNSYGTDWGESGYLKLARNANNMCGVASL 330
            .|...|:|||||:||.::.|: |||:|||:|..|||.||.::.|..:. |.:.|:
 Frog   395 FQLTNHAVLLVGYGTDQQTGEKYWIVKNSWGESWGEKGYFRIRRGTDE-CAIESI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 73/225 (32%)
ctscXP_012812143.2 CathepsinC_exc 20..136 CDD:400909
Peptidase_C1A_CathepsinC 226..455 CDD:239112 73/227 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.