DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and ctsba

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_998501.1 Gene:ctsba / 406645 ZFINID:ZDB-GENE-040426-2650 Length:330 Species:Danio rerio


Alignment Length:277 Identity:76/277 - (27%)
Similarity:113/277 - (40%) Gaps:90/277 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 QITEGI----------DWRQYGYISPVGDQGTECLSCWAFSTSGVLEA-------HMAKKYGNLV 164
            |.|||:          .|.....:..:.|||: |.|||||   |..||       |...|..  |
Zfish    72 QYTEGLKLPKNFDAREQWPNCPTLKEIRDQGS-CGSCWAF---GAAEAISDRVCIHSDAKVS--V 130

  Fly   165 PLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIATKESY-------PY-------------EP 209
            .:|.:.|:.|......||:||:.|.|:::....|:.|...|       ||             .|
Zfish   131 EISSQDLLTCCDSCGMGCNGGYPSAAWDFWATEGLVTGGLYNSHIGCRPYTIEPCEHHVNGSRPP 195

  Fly   210 VSGE----------C------LWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHE 258
            .|||          |      .:|.|:..|..| |....|.:. .:||:..| |||..:.. ::|
Zfish   196 CSGEGGDTPNCDMKCEPGYSPSYKQDKHFGKTS-YSVPSNQNS-IMAELFKN-GPVEGAFT-VYE 256

  Fly   259 EFDQYSGGVLSIPACRSKRQDLT------HSVLLVGFGTHRKWGD-----YWIIKNSYGTDWGES 312
            :|..|..||.         |.::      |::.::|      ||:     ||:..||:.||||::
Zfish   257 DFLLYKSGVY---------QHMSGSPVGGHAIKILG------WGEENGVPYWLAANSWNTDWGDN 306

  Fly   313 GYLKLARNANNMCGVAS 329
            ||.|:.|..:: ||:.|
Zfish   307 GYFKILRGEDH-CGIES 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 74/274 (27%)
ctsbaNP_998501.1 Propeptide_C1 25..64 CDD:285358
Peptidase_C1A_CathepsinB 80..327 CDD:239111 72/269 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.