DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and ctss1

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_017207692.1 Gene:ctss1 / 393398 ZFINID:ZDB-GENE-040426-1583 Length:342 Species:Danio rerio


Alignment Length:337 Identity:120/337 - (35%)
Similarity:189/337 - (56%) Gaps:24/337 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILLLLVELGLTAVS---------DTEWDQYKAKYNKQYRN--RDKYHRALYEQRVLAVESHNQLY 66
            :|::...|.|..||         ..:|..:|:::||.|||  .::..|::::|.:..:..||:..
Zfish    15 MLVIRCALVLVCVSLVGCEIRRLTNQWTTWKSQHNKTYRNTREERLRRSVWKQNLQDILLHNEAA 79

  Fly    67 LQGKVAFKMGLNKFSD-TDQRILFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYI 130
            ..|..::.:|||:.|| |...:     :.:...||.....:..|.:......:.:.::|.::|.:
Zfish    80 AVGLHSYTLGLNQLSDMTADEV-----NDMNGLLEEDFPDVNATFSPPSLQTLPQRVNWTEHGMV 139

  Fly   131 SPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDC-VPYPNNGCSGGWVSVAFNYT 194
            |||.:|| .|.||||||..|.|||.|.::...|||||.::|:|| |...|.||.||::|.||.|.
Zfish   140 SPVQNQG-PCGSCWAFSAVGSLEAQMKRRTAALVPLSAQNLLDCSVSLGNRGCKGGFLSRAFLYV 203

  Fly   195 -RDHGIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHE 258
             ::.||.:...||||...|.|.:.....||..:|:..:..::|..|...|.|||||:|.|:....
Zfish   204 IQNRGIDSSTFYPYEHKEGVCRYSVSGRAGYCTGFRIVPRHNEAALQSAVANIGPVSVGINAKLL 268

  Fly   259 EFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANN 323
            .|.:|..|:.:.|.|.|..  :.|:||:||:|: ....|||::|||:||.|||:||:::||| .|
Zfish   269 SFHRYRSGIYNDPKCSSAL--INHAVLVVGYGS-ENGQDYWLVKNSWGTAWGENGYIRMARN-KN 329

  Fly   324 MCGVASLPQYPT 335
            |||::|...|||
Zfish   330 MCGISSFGIYPT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 18/57 (32%)
Peptidase_C1A 120..334 CDD:239068 91/215 (42%)
ctss1XP_017207692.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.