DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Swim

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster


Alignment Length:343 Identity:93/343 - (27%)
Similarity:136/343 - (39%) Gaps:63/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKAKYNKQYRNRDKYHRALYEQRV-----------LAVESHNQLYLQGKVA----------FKMG 76
            |.:|||..:.|.::. |.|....|           ..|.|.|.::..|..|          :..|
  Fly    97 YFSKYNTTWDNCNEC-RCLEGGSVQCDEDLCLTDDAIVHSVNSIHRLGWSARKYDQWWGRKYSEG 160

  Fly    77 LNKFSDTDQRILFNYRSSIPAPLETSTNALTETVNYKRYDQITEGID-WRQYGYISPVGDQGTEC 140
            |.....|.:.   .||......|:..|:.|..:.|         .:| |.  .|||.|.|||. |
  Fly   161 LKLRLGTKEP---TYRVKAMTRLKNPTDGLPSSFN---------ALDKWS--SYISEVPDQGW-C 210

  Fly   141 LSCWAFSTSGVLEAHMA--KKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIATKE 203
            .:.|..||:.|.....|  .|....|.||.::::.|. ....||.||.:..|:.|....|:..:.
  Fly   211 GASWVLSTTSVASDRFAIQSKGKENVQLSAQNILSCT-RRQQGCEGGHLDAAWRYLHKKGVVDEN 274

  Fly   204 SYPYEPVSGECLWKSDRSAGTLSGYVTLGNYD---------------ERELAEVVYNIGPVAVSI 253
            .|||......|..:.:..:...:|.....|.|               |.::...:::.|||..::
  Fly   275 CYPYTQHRDTCKIRHNSRSLRANGCQKPVNVDRDSLYTVGPAYSLNREADIMAEIFHSGPVQATM 339

  Fly   254 DHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLA 318
             .::.:|..|||||....|...|.....|||.|||:|.......|||..||:|:.|||.||.::.
  Fly   340 -RVNRDFFAYSGGVYRETAANRKAPTGFHSVKLVGWGEEHNGEKYWIAANSWGSWWGEHGYFRIL 403

  Fly   319 RNANNMCGV-----ASLP 331
            |.:|. ||:     ||.|
  Fly   404 RGSNE-CGIEEYVLASWP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 16/72 (22%)
Peptidase_C1A 120..334 CDD:239068 71/235 (30%)
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663 8/29 (28%)
Peptidase_C1A_CathepsinB 188..417 CDD:239111 69/243 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.