DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL3 and cer

DIOPT Version :10

Sequence 1:NP_649608.1 Gene:CtsL3 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster


Alignment Length:62 Identity:23/62 - (37%)
Similarity:39/62 - (62%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LTAVSDTEWDQYKAKYNKQYR-NRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD 82
            ::.|||.||.:||:|::|.|. ..|...|.:|.:....:|.||:.:.:|:|.:|||:|..:|
  Fly     1 MSLVSDEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLAD 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL3NP_649608.1 Inhibitor_I29 30..85 CDD:462410 19/54 (35%)
Peptidase_C1A 120..334 CDD:239068
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 19/54 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.