| Sequence 1: | NP_649608.1 | Gene: | CtsL3 / 40741 | FlyBaseID: | FBgn0037396 | Length: | 336 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611420.1 | Gene: | cer / 37229 | FlyBaseID: | FBgn0034443 | Length: | 79 | Species: | Drosophila melanogaster |
| Alignment Length: | 62 | Identity: | 23/62 - (37%) |
|---|---|---|---|
| Similarity: | 39/62 - (62%) | Gaps: | 1/62 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 22 LTAVSDTEWDQYKAKYNKQYR-NRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD 82 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CtsL3 | NP_649608.1 | Inhibitor_I29 | 30..85 | CDD:462410 | 19/54 (35%) |
| Peptidase_C1A | 120..334 | CDD:239068 | |||
| cer | NP_611420.1 | Inhibitor_I29 | 9..68 | CDD:462410 | 19/54 (35%) |
| Blue background indicates that the domain is not in the aligned region. | |||||