powered by:
Protein Alignment CG11459 and cer
DIOPT Version :9
Sequence 1: | NP_001287191.1 |
Gene: | CG11459 / 40741 |
FlyBaseID: | FBgn0037396 |
Length: | 336 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611420.1 |
Gene: | cer / 37229 |
FlyBaseID: | FBgn0034443 |
Length: | 79 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 23/62 - (37%) |
Similarity: | 39/62 - (62%) |
Gaps: | 1/62 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 LTAVSDTEWDQYKAKYNKQYR-NRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD 82
::.|||.||.:||:|::|.|. ..|...|.:|.:....:|.||:.:.:|:|.:|||:|..:|
Fly 1 MSLVSDEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLAD 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
49 |
1.000 |
Domainoid score |
I11780 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.