DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CG4847

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster


Alignment Length:297 Identity:107/297 - (36%)
Similarity:159/297 - (53%) Gaps:18/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RALYEQRVLA----VESHNQLYLQGKVAFKMGLNKFSDTDQRILFNYRSSIPAPLETSTNALT-- 107
            |||:|....:    ||:.|..:.||...||..:|.|:|.......:..:.:....|....|..  
  Fly   129 RALHEGAFASTKNLVEAGNAAFAQGVHTFKQAVNAFADLTHSEFLSQLTGLKRSPEAKARAAASL 193

  Fly   108 ETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLV 172
            :.||... ..|.:..|||::|.::||..||| |.|||||:|:|.:|.|..:|.|:|..||.::||
  Fly   194 KLVNLPA-KPIPDAFDWREHGGVTPVKFQGT-CGSCWAFATTGAIEGHTFRKTGSLPNLSEQNLV 256

  Fly   173 DCVPYPN---NGCSGGWVSVAFNYTRD--HGIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLG 232
            ||.|..:   |||.||:...||.:..:  .|::.:.:|||....|.|.:...:|..||.|:..:.
  Fly   257 DCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCKYDGSKSGATLQGFAAIP 321

  Fly   233 NYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGD 297
            ..||.:|.:||..:||||.|::.| |....|:||:.:...|  .:.:..||:|:||:|: .|..|
  Fly   322 PKDEEQLKKVVATLGPVACSVNGL-ETLKNYAGGIYNDDEC--NKGEPNHSILVVGYGS-EKGQD 382

  Fly   298 YWIIKNSYGTDWGESGYLKLARNANNMCGVASLPQYP 334
            |||:|||:...|||.||.:|.| ..|.|.:|....||
  Fly   383 YWIVKNSWDDTWGEKGYFRLPR-GKNYCFIAEECSYP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 14/39 (36%)
Peptidase_C1A 120..334 CDD:239068 86/218 (39%)
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 14/42 (33%)
Peptidase_C1A 204..418 CDD:239068 86/219 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452943
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.