DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and ctsc

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_999887.1 Gene:ctsc / 368704 ZFINID:ZDB-GENE-030619-9 Length:455 Species:Danio rerio


Alignment Length:312 Identity:85/312 - (27%)
Similarity:148/312 - (47%) Gaps:36/312 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSDTDQRILFNY-----------RSSIPAP 98
            |:.|...:|.|:|.     :|.....:.|...:|....:.....:::           ||..||.
Zfish   144 DRRHMLGFEHRLLM-----KLPYTNNMMFVDEINSVQKSWTATAYSFHETLSIHEMLRRSGGPAS 203

  Fly    99 -LETSTNALTETVNYKRYDQITEGIDWRQ---YGYISPVGDQGTECLSCWAFSTSGVLEAHMAKK 159
             :......:|...:.|....:.:..|||.   ..::|||.:| .:|.||::|:|.|:|||.:..:
Zfish   204 RIPRRVRPVTVAADSKAASGLPQHWDWRNVNGVNFVSPVRNQ-AQCGSCYSFATMGMLEARVRIQ 267

  Fly   160 YGNLVP--LSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIATKESYPYEPVSGECLWKSDRSA 222
            ..|...  .||:.:|.|..| :.||.||:..:...|.:|.||..::.:||......|...:..:.
Zfish   268 TNNTQQPVFSPQQVVSCSQY-SQGCDGGFPYLIGKYIQDFGIVEEDCFPYTGSDSPCNLPAKCTK 331

  Fly   223 GTLSGYVTLGNY-----DERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQ--DL 280
            ...|.|..:|.:     :...:.|:|.| ||:.|::: ::.:|..|..|:......|....  :|
Zfish   332 YYASDYHYVGGFYGGCSESAMMLELVKN-GPMGVALE-VYPDFMNYKEGIYHHTGLRDANNPFEL 394

  Fly   281 T-HSVLLVGFGTHRKWGD-YWIIKNSYGTDWGESGYLKLARNANNMCGVASL 330
            | |:|||||:|...|.|: |||:|||:|:.|||:|:.::.|..:. |.:.|:
Zfish   395 TNHAVLLVGYGQCHKTGEKYWIVKNSWGSGWGENGFFRIRRGTDE-CAIESI 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 8/39 (21%)
Peptidase_C1A 120..334 CDD:239068 71/225 (32%)
ctscNP_999887.1 CathepsinC_exc 20..132 CDD:285926
Peptidase_C1A_CathepsinC 224..452 CDD:239112 71/227 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.