DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CG6357

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster


Alignment Length:107 Identity:23/107 - (21%)
Similarity:46/107 - (42%) Gaps:17/107 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WDQYKAKYNKQYRN--RDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD-------TDQ 85
            |:::...:...|::  ..:..|.::.....::..||..:..|.::||.|:|::||       ..|
  Fly   252 WEKFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNVQFDLGNISFKKGINQWSDLTVEEWKNKQ 316

  Fly    86 RILFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQY 127
            |..||       |..:...|.|:....||.|...:.. |:::
  Fly   317 RPAFN-------PEFSKVEATTKISKDKRDDNTCQAA-WKKF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 12/63 (19%)
Peptidase_C1A 120..334 CDD:239068 1/8 (13%)
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853 12/58 (21%)
Inhibitor_I29 347..406 CDD:214853 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.